apple-not-yet.htm0000644000175000017500000000322211655374611012724 0ustar billbill Not yet available at iBookstore

This book is not yet available at Apple's iBookstore

We are working to make this book available via iBookstore, currently you can read it on an iPad or iPhone using the Kindle App.

Available ebook or paperbound Available ebook or paperbound
css/0000755000175000017500000000000011660232477010304 5ustar billbillcss/book-pages-three-column.css0000644000175000017500000000366211660232477015454 0ustar billbill#layoutdims { clear:both; background:#eee; border-top:4px solid #000; margin:0; padding:6px 15px !important; text-align:right; } /* column container */ .colmask { position:relative; /* This fixes the IE7 overflow hidden bug */ clear:both; float:left; width:100%; /* width of whole page */ overflow:hidden; /* This chops off any overhanging divs */ } /* common column settings */ .colright, .colmid, .colleft { float:left; width:100%; /* width of page */ position:relative; } .col1, .col2, .col3 { float:left; position:relative; padding:0 0 1em 0; /* no left and right padding on columns, we just make them narrower instead only padding top and bottom is included here, make it whatever value you need */ overflow:hidden; } /* 3 Column settings */ .threecol { background:#f4f4f4; /* right column background colour */ } .threecol .colmid { right:25%; /* width of the right column */ background:#fff; /* center column background colour */ } .threecol .colleft { right:50%; /* width of the middle column */ background:#ffffff; /* left column background colour */ } .threecol .col1 { width:46%; /* width of center column content (column width minus padding on either side) */ left:102%; /* 100% plus left padding of center column */ } .threecol .col2 { width:21%; /* Width of left column content (column width minus padding on either side) */ left:31%; /* width of (right column) plus (center column left and right padding) plus (left column left padding) */ } .threecol .col3 { width:21%; /* Width of right column content (column width minus padding on either side) */ left:85%; /* Please make note of the brackets here: (100% - left column width) plus (center column left and right padding) plus (left column left and right padding) plus (right column left padding) */ } /* Footer styles */ #footer { clear:both; float:left; width:100%; border-top:1px solid #000; } #footer p { padding:10px; margin:0; } css/book-pages-global.css0000644000175000017500000000546711660067445014320 0ustar billbillbody { margin:0; padding:0; border:0; /* This removes the border around the viewport in old versions of IE */ width:100%; background:#fffcdf; min-width:600px; /* Minimum width of layout - remove line if not required */ /* The min-width property does not work in old versions of Internet Explorer */ font-size:90%; } a { color:#369; } a:hover { color:#fff; background:#369; text-decoration:none; } h1, h2, h3 { margin:.8em 0 .2em 0; padding:0; } /* Set font info */ h1 { font-family:verdana,arial,helvetica,sans-serif;font-weight:bold; } h2 { font-family:verdana,arial,helvetica,sans-serif;font-weight:bold } h3 { font-family:georgia,serif;font-weight: bold; } p {font-family:georgia,serif;} quote {font-family:georgia,serif;font-style:italic} p-book-title {font-family:; verdana,arial,helvetica,sans-serif;font-weight:bold;font-size:0.8em} p-book-isbn {font-family:verdana,arial,helvetica,sans-serif;font-style:italic;font-weight:bold;color:gray;font-size:0.7em} p-book-details {font-family: verdana,arial,helvetica,sans-serif;font-style: italic;font-weight:regular;color:black;font-size:0.7em} p-book-price{font-family: verdana,arial,helvetica,sans-serif;font-weight:bold;color:red;font-size:1.25em; text-align: center } p.contents{font-family: verdana,arial,helvetica,sans-serif;font-weight:bold;color:gray;font-size:0.9em; } p-ibook-link{font-family: verdana,arial,helvetica,sans-serif;font-weight:normal;color:black;font-size:0.9em; } .center {text-align: center;} ul {font-family:claredon,georgia,serif;} span.bold-red{color:red;font-weight:bold} p { margin:.4em 0 .8em 0; padding:0; } p-book-price { padding:0; } img { margin:10px 0 5px; } img.floatLeft { float: left; margin-left:0px; margin-right:5px; } img.floatRight { float: right; margin-right:5px; } img.floatRight-bottom { float: right; margin-right:5px; } #ads img { display:block; padding-top:10px; } /* Header styles */ #header { clear:both; float:left; width:100%; } #header { border-bottom:1px solid #000; border-top:10px solid #ffffff;text-align:center } #header p, #header h1, #header h2 { padding:.4em 15px 0 15px; margin:0; } #header ul { clear:left; float:left; width:100%; list-style:none; margin:10px 0 0 0; padding:0; } #header ul li { display:inline; list-style:none; margin:0; padding:0; } #header ul li a { display:block; float:left; margin:0 0 0 1px; padding:3px 10px; text-align:center; background:#eee; color:#000; text-decoration:none; position:relative; left:15px; line-height:1.3em; } #header ul li a:hover { background:#369; color:#fff; } #header ul li a.active, #header ul li a.active:hover { color:#fff; background:#000; font-weight:bold; } #header ul li a span { display:block; } img.center { padding: 6px; display:block; margin-left:auto; margin-right:auto; } css/delete.css0000644000175000017500000001047611657520543012270 0ustar billbillbody { margin:0; padding:0; border:0; /* This removes the border around the viewport in old versions of IE */ width:100%; background:#fffcdf; min-width:600px; /* Minimum width of layout - remove line if not required */ /* The min-width property does not work in old versions of Internet Explorer */ font-size:90%; } a { color:#369; } a:hover { color:#fff; background:#369; text-decoration:none; } h1, h2, h3 { margin:.8em 0 .2em 0; padding:0; } /* Set font info */ @font-face {font-family: clarendon; src: url(fonts/tt0283m_.ttf) format("truetype");} @font-face {font-family: clarendon; font-weight: lighter;src: url(fonts/tt0282m_.ttf) format("truetype");} @font-face {font-family: clarendon; font-weight: bold;src: url(fonts/tt0284m_.ttf) format("truetype");} @font-face {font-family: solex; src: url(fonts/SolexBla.ttf) format("truetype");} h1 { font-family:verdana,arial,helvetica,sans-serif;font-weight:bold; } h2 { font-family:verdana,arial,helvetica,sans-serif;font-weight:bold } h3 { font-family:georgia,serif;font-weight: bold; } p {font-family:georgia,serif;} quote {font-family:georgia,serif;font-style:italic} p-book-title {font-family:; verdana,arial,helvetica,sans-serif;font-weight:bold;font-size:0.8em} p-book-isbn {font-family:verdana,arial,helvetica,sans-serif;font-style:italic;font-weight:bold;color:gray;font-size:0.7em} p-book-details {font-family: verdana,arial,helvetica,sans-seri;font-style: italic;font-weight:regular;color:black;font-size:0.7em} p-book-price{font-family: verdana,arial,helvetica,sans-seri;font-weight:bold;color:red;font-size:1.25em; text-align: center } p.contents{font-family: verdana,arial,helvetica,sans-seri;font-weight:bold;color:gray;font-size:0.9em; } .center {text-align: center;} ul {font-family:claredon,georgia,serif;} span.bold-red{color:red;font-weight:bold} p { margin:.4em 0 .8em 0; padding:0; } p-book-price { padding:0; } img { margin:10px 0 5px; } img.floatLeft { float: left; margin-left:0px; margin-right:5px; } img.floatRight { float: right; margin-right:5px; } img.floatRight-bottom { float: right; margin-right:5px; } #ads img { display:block; padding-top:10px; } /* Header styles */ #header { clear:both; float:left; width:100%; } #header { border-bottom:1px solid #000; border-top:10px solid #ffffff;text-align:center } #header p, #header h1, #header h2 { padding:.4em 15px 0 15px; margin:0; } #header ul { clear:left; float:left; width:100%; list-style:none; margin:10px 0 0 0; padding:0; } #header ul li { display:inline; list-style:none; margin:0; padding:0; } #header ul li a { display:block; float:left; margin:0 0 0 1px; padding:3px 10px; text-align:center; background:#eee; color:#000; text-decoration:none; position:relative; left:15px; line-height:1.3em; } #header ul li a:hover { background:#369; color:#fff; } #header ul li a.active, #header ul li a.active:hover { color:#fff; background:#000; font-weight:bold; } #header ul li a span { display:block; } img.center { padding: 6px; display:block; margin-left:auto; margin-right:auto; } /* 'widths' sub menu */ #layoutdims { clear:both; background:#ffffff; #border-top:4px solid #000; margin:0; padding:6px 15px !important; text-align:right; } /* column container */ .colmask { position:relative; /* This fixes the IE7 overflow hidden bug */ clear:both; float:left; width:100%; /* width of whole page */ overflow:hidden; /* This chops off any overhanging divs */ } /* common column settings */ .colright, .colmid, .colleft { float:left; width:100%; position:relative; } .col1, .col2, .col3 { float:left; position:relative; padding:0 0 1em 0; overflow:hidden; } /* 2 Column (left menu) settings */ .leftmenu { background:#fff; /* right column background colour */ } .leftmenu .colleft { right:75%; /* right column width */ background:#f4f4f4; /* left column background colour */ } .leftmenu .col1 { width:71%; /* right column content width */ left:102%; /* 100% plus left column left padding */ } .leftmenu .col2 { width:21%; /* left column content width (column width minus left and right padding) */ left:6%; /* (right column left and right padding) plus (left column left padding) */ } /* Footer styles */ #footer { clear:both; float:left; width:100%; border-top:1px solid #000; } #footer p { padding:10px; margin:0; }css/test.css0000644000175000017500000001215311655650733012002 0ustar billbill /* General styles */ body { margin:0; padding:0; border:0; /* This removes the border around the viewport in old versions of IE */ width:100%; background:#fff; min-width:600px; /* Minimum width of layout - remove line if not required */ /* The min-width property does not work in old versions of Internet Explorer */ font-size:90%; } a { color:#369; } a:hover { color:#fff; background:#369; text-decoration:none; } h1, h2, h3 { margin:.8em 0 .2em 0; padding:0; clear:both; } h1 { font-family:verdana,arial,helvetica,sans-serif;font-weight:bold; } h2 { font-family:verdana,arial,helvetica,sans-serif;font-weight:bold } h3 { font-family:georgia,serif;font-weight: bold; } p {font-family:georgia,serif;} quote {font-family:georgia,serif;font-style:italic} p-book-title {font-family:; verdana,arial,helvetica,sans-serif;font-weight:bold;font-size:0.8em} p-book-isbn {font-family:verdana,arial,helvetica,sans-serif;font-style:italic;font-weight:bold;color:gray;font-size:0.7em} p-book-details {font-family: verdana,arial,helvetica,sans-seri;font-style: italic;font-weight:regular;color:black;font-size:0.7em} p-book-price{font-family: verdana,arial,helvetica,sans-seri;font-weight:bold;color:red;font-size:1.25em; text-align: center } p.contents{font-family: verdana,arial,helvetica,sans-seri;font-weight:bold;color:gray;font-size:0.9em; } .center {text-align: center;} ul {font-family:claredon,georgia,serif;} span.bold-red{color:red;font-weight:bold} p { margin:.4em 0 .8em 0; padding:0; } img { margin:10px 0 5px; } #ads { width:100%; padding:20px 0; } #ads #mjt { float:left; margin-bottom:20px; } #ads .adhere { margin:0 10px 10px 0; } #ads img { display:block; margin:0; } /* download link */ .download { clear:both; float:left; padding-top:10px; } .download a { padding:.3em .5em !important; margin-right:10px; background:#00bd3e; text-decoration:none; color:#fff; font-weight:bold; font-size:1.5em; -moz-border-radius:.3em; -webkit-border-radius:.3em; border-radius:.3em; line-height:2.5em; -moz-box-shadow: 1px 1px 2px #888; -webkit-box-shadow: 1px 1px 2px #888; box-shadow: 1px 1px 2px #888; } .download a:hover { background:#5f534f; text-shadow: 2px 2px 2px #000; } /* Header styles */ #header { clear:both; float:left; width:100%; } #header { border-bottom:1px solid #000; } #header p, #header h1, #header h2 { padding:.4em 15px 0 15px; margin:0; } #header ul { clear:left; float:left; width:100%; list-style:none; margin:10px 0 0 0; padding:0; } #header ul li { display:inline; list-style:none; margin:0; padding:0; } #header ul li a { display:block; float:left; margin:0 0 0 1px; padding:3px 10px; text-align:center; background:#eee; color:#000; text-decoration:none; position:relative; left:15px; line-height:1.3em; } #header ul li a:hover { background:#369; color:#fff; } #header ul li a.active, #header ul li a.active:hover { color:#fff; background:#000; font-weight:bold; } #header ul li a span { display:block; } /* 'widths' sub menu */ #layoutdims { clear:both; background:#eee; border-top:4px solid #000; margin:0; padding:6px 15px !important; text-align:right; } /* column container */ .colmask { position:relative; /* This fixes the IE7 overflow hidden bug */ clear:both; float:left; width:100%; /* width of whole page */ overflow:hidden; /* This chops off any overhanging divs */ } /* common column settings */ .colright, .colmid, .colleft { float:left; width:100%; /* width of page */ position:relative; } .col1, .col2, .col3 { float:left; position:relative; padding:0 0 1em 0; /* no left and right padding on columns, we just make them narrower instead only padding top and bottom is included here, make it whatever value you need */ overflow:hidden; } /* 3 Column settings */ .threecol { background:#eee; /* right column background colour */ } .threecol .colmid { right:25%; /* width of the right column */ background:#fff; /* center column background colour */ } .threecol .colleft { right:50%; /* width of the middle column */ background:#f4f4f4; /* left column background colour */ } .threecol .col1 { width:46%; /* width of center column content (column width minus padding on either side) */ left:102%; /* 100% plus left padding of center column */ } .threecol .col2 { width:21%; /* Width of left column content (column width minus padding on either side) */ left:31%; /* width of (right column) plus (center column left and right padding) plus (left column left padding) */ } .threecol .col3 { width:21%; /* Width of right column content (column width minus padding on either side) */ left:85%; /* Please make note of the brackets here: (100% - left column width) plus (center column left and right padding) plus (left column left and right padding) plus (right column left padding) */ } /* Footer styles */ #footer { clear:both; float:left; width:100%; border-top:1px solid #000; } #footer p { padding:10px; margin:0; } /* --> */css/book-pages.css-old0000644000175000017500000001006511657522315013622 0ustar billbillbody { margin:0; padding:0; border:0; /* This removes the border around the viewport in old versions of IE */ width:100%; background:#fffcdf; min-width:600px; /* Minimum width of layout - remove line if not required */ /* The min-width property does not work in old versions of Internet Explorer */ font-size:90%; } a { color:#369; } a:hover { color:#fff; background:#369; text-decoration:none; } h1, h2, h3 { margin:.8em 0 .2em 0; padding:0; } /* Set font info */ h1 { font-family:verdana,arial,helvetica,sans-serif;font-weight:bold; } h2 { font-family:verdana,arial,helvetica,sans-serif;font-weight:bold } h3 { font-family:georgia,serif;font-weight: bold; } p {font-family:georgia,serif;} quote {font-family:georgia,serif;font-style:italic} p-book-title {font-family:; verdana,arial,helvetica,sans-serif;font-weight:bold;font-size:0.8em} p-book-isbn {font-family:verdana,arial,helvetica,sans-serif;font-style:italic;font-weight:bold;color:gray;font-size:0.7em} p-book-details {font-family: verdana,arial,helvetica,sans-serif;font-style: italic;font-weight:regular;color:black;font-size:0.7em} p-book-price{font-family: verdana,arial,helvetica,sans-serif;font-weight:bold;color:red;font-size:1.25em; text-align: center } p.contents{font-family: verdana,arial,helvetica,sans-serif;font-weight:bold;color:gray;font-size:0.9em; } p-ibook-link{font-family: verdana,arial,helvetica,sans-serif;font-weight:normal;color:black;font-size:0.9em; } .center {text-align: center;} ul {font-family:claredon,georgia,serif;} span.bold-red{color:red;font-weight:bold} p { margin:.4em 0 .8em 0; padding:0; } p-book-price { padding:0; } img { margin:10px 0 5px; } img.floatLeft { float: left; margin-left:0px; margin-right:5px; } img.floatRight { float: right; margin-right:5px; } img.floatRight-bottom { float: right; margin-right:5px; } #ads img { display:block; padding-top:10px; } /* Header styles */ #header { clear:both; float:left; width:100%; } #header { border-bottom:1px solid #000; border-top:10px solid #ffffff;text-align:center } #header p, #header h1, #header h2 { padding:.4em 15px 0 15px; margin:0; } #header ul { clear:left; float:left; width:100%; list-style:none; margin:10px 0 0 0; padding:0; } #header ul li { display:inline; list-style:none; margin:0; padding:0; } #header ul li a { display:block; float:left; margin:0 0 0 1px; padding:3px 10px; text-align:center; background:#eee; color:#000; text-decoration:none; position:relative; left:15px; line-height:1.3em; } #header ul li a:hover { background:#369; color:#fff; } #header ul li a.active, #header ul li a.active:hover { color:#fff; background:#000; font-weight:bold; } #header ul li a span { display:block; } img.center { padding: 6px; display:block; margin-left:auto; margin-right:auto; } /* 'widths' sub menu */ #layoutdims { clear:both; background:#ffffff; #border-top:4px solid #000; margin:0; padding:6px 15px !important; text-align:right; } /* column container */ .colmask { position:relative; /* This fixes the IE7 overflow hidden bug */ clear:both; float:left; width:100%; /* width of whole page */ overflow:hidden; /* This chops off any overhanging divs */ } /* common column settings */ .colright, .colmid, .colleft { float:left; width:100%; position:relative; } .col1, .col2, .col3 { float:left; position:relative; padding:0 0 1em 0; overflow:hidden; } /* 2 Column (left menu) settings */ .leftmenu { background:#fff; /* right column background colour */ } .leftmenu .colleft { right:75%; /* right column width */ background:#f4f4f4; /* left column background colour */ } .leftmenu .col1 { width:71%; /* right column content width */ left:102%; /* 100% plus left column left padding */ } .leftmenu .col2 { width:21%; /* left column content width (column width minus left and right padding) */ left:6%; /* (right column left and right padding) plus (left column left padding) */ } /* Footer styles */ #footer { clear:both; float:left; width:100%; border-top:1px solid #000; } #footer p { padding:10px; margin:0; }css/book-pages-two-column.css0000644000175000017500000000237611660067477015165 0ustar billbill/* 'widths' sub menu */ #layoutdims { clear:both; background:#ffffff; #border-top:4px solid #000; margin:0; padding:6px 15px !important; text-align:right; } /* column container */ .colmask { position:relative; /* This fixes the IE7 overflow hidden bug */ clear:both; float:left; width:100%; /* width of whole page */ overflow:hidden; /* This chops off any overhanging divs */ } /* common column settings */ .colright, .colmid, .colleft { float:left; width:100%; position:relative; } .col1, .col2, .col3 { float:left; position:relative; padding:0 0 1em 0; overflow:hidden; } /* 2 Column (left menu) settings */ .leftmenu { background:#fff; /* right column background colour */ } .leftmenu .colleft { right:75%; /* right column width */ background:#f4f4f4; /* left column background colour */ } .leftmenu .col1 { width:71%; /* right column content width */ left:102%; /* 100% plus left column left padding */ } .leftmenu .col2 { width:21%; /* left column content width (column width minus left and right padding) */ left:6%; /* (right column left and right padding) plus (left column left padding) */ } /* Footer styles */ #footer { clear:both; float:left; width:100%; border-top:1px solid #000; } #footer p { padding:10px; margin:0; }delete.htm0000644000175000017500000002324311660104522011461 0ustar billbill Announcing: Bill Hammack's Essays on Engineering

About the book

In over 200 delightful short essays - over 422 pages! - Bill captures the creativity and impact of engineers. He talks of their spectacular achievements - jets, satellites, skyscrapers, and fiber optics; but draws his deepest insights from the everyday, the quotidian. He finds beauty, elegance and meaning in Ferris wheels, Tupperware, Slinkys, mood rings, waterless urinals and Velcro. Delivered originally on public radio between 1999 and 2006, each essay is a small slice of the world created by engineers. The essays also illuminate and inform about the important topics of our day by showing how intertwined engineering and technology are with terrorism, security, intellectual property and our cultural legacy.

purchase book " alt="Amazon-paperback-over-image"/> " alt="Kindle-over-image"/> " alt="Amazon-paperbound-logo"/> " alt="Kindle"/> " alt="Nook (Barnes & Noble"/> " alt="Google Books"/> " alt="iBookstore"/>

What's inside the book

The book is best read by flipping it open at random and letting the essays come at your by chance as they did for his public radio listeners. A good way to get a feel for the book is to browse samples. Unlike the videos the essays just capture a slice of the world of engineers. Science Magazine captured the spirit best:

"Bill Hammack can rhapsodize over the clever design of a soda can or a Scotch tape dispenser .... His light, often humorous essays also provide insight into the cultural forces that speed or hamper the acceptance of new products and the inventors' often unexpected sources of inspiration.”

 

Perhaps the best way to approach the book is through is through its thematic table of contents.

  • Inventions & Inventors Air Conditioning | Better Mousetraps | Blue LED | Bob Kearns | Bose Wave Radio | Coffee Maker | Color Film Chemistry | Composting Toilets | Concrete | Contact Lens | Cornstarch Packing Peanuts | Cruise Control | Directional Sound | Duct Tape | Elevators | Gas Lighting | Geiger Counters | George Eastman & Kodak | Glass | Glo-sheet | Glowing Hockey Puck | Gore-Tex | GPS | Grain Elevators | Hazel Bishop | Jack Kilby | Jell-O | Lava Lamp | Maclaren Strollers | Margaret Knight & Paper bags | Matches | Mauve | Moen Faucets | Mood Rings | Neon | Nitinol | Nylon | O-Rings | Phillips Screws | Philo Farnsworth | Photocopiers | Pop Rocks Candy | Pumpkin masters | Razor | RFID | Saul Griffith | Scotch tape dispenser | Sliced Bread | Spam | Stay-on Tab | Steadicam | Superglue | Super Soaker | Surveillance Tags | Swimsuits | Television Remote Control | Tupperware | Typewriters | Ultrasound imaging | Vacuum Cleaners | Vaseline | Velcro | Video games | Volkswagen Beetle | Wind-Up Radio
  • Art, Literature & Music The Beatles | eBooks | Fahrenheit 451 | Hammond Organ | Jekyll & Hyde | Leonardo da Vinci | Lord of the Rings | Pompeii the Novel | Project Gutenberg | Saxophone | Theremin | TiVo | Zildjian Cymbals
  • Technology & Society Accurate Throwing | Anthrax | The Calendar | Cigarette Machine | Color Film & Determinism | Colton | Container Ships | Counting People | Cryonics | Diapers | Education & Technology | The Electrical Chair | The Electronic Paper Trail of Terrorism | Escapement | Face Recognition Software | Genetically Modified Food | Gridlock | HeLa Cells | Housework | Laundry Machines | Machine Guns | Thomas Midgley | Numbers | Numbers & Empire | Potholes | Risk | SARS | Science & the Declaration | Technology & 911 | Technology & Terrorism | Voting & Paper | Voting machines & gambling | Waterless Urinals
  • Computers & Information Technology Adam Osborne | Apple’s Killer App | Atomic Clock | Cell Phones | Claude Shannon | Disc vs Disk | Digital data | Dvorak Keyboard | Fiber Optics | First E-mail Message | Google | IETF & Domain Names | Iridium Satellites | Landlines & the Five Nines | LEO Computer | Monocultures & viruses | Moore’s Law | The Mouse | MUZAK | Open Source | J.R. Pierce & Satellites | Public Key Encryption | Rolodex | Silicon | Spam | Thomas Stockham | Text Messages | The Telegraph | The Queen of Voice mail | Voice Over IP & 911
  • Energy & Environment Batteries in the Frig | Blackout Reading | Electric Cars | Garbage | Hydrogen-Powered Cars | Local Power | Los Angeles | Nitrogen Fixation | Partially Zero Emissions | The Power Grid | Proven Oil Reserves | Recycling | Wind Energy
  • Toys, Sports, Travel & Entertainment Baseball Stats | Bicycles | eBay | Ferris Wheels | Frisbee | The Ice Hotel | Lego Toy Company | Legos | Nautilus Machines | Olympic Flame | Olympics & Technology | On-line shopping | Ping Putter | Roller Coasters | SCUBA | Slinky | Terry Bicycles | Tour de France | Waiting in Line
  • Food & Cooking Champagne | Clarence Birdseye | Cooking a Turkey | Corks | Ice Cream | Microwave ovens
  • FlightAirships | Black Box | Boeing vs. Airbus | Concorde | Jet Takeoff | SpaceShipOne | Stall Warning Detector
  • Engineering Methods & Design Bathtubs | Betamax vs VHS | Bolts | Demolition | Engineering Heritage | Eulogy for Old Technologies | Fluid Flow | Fracture Mechanics | Henry Dreyfuss | Mass Manufacturing | Nanotechnology | New vs. Old Technology | Packaging | Plasmas | Sears Tower | Strobe Light Photography | Swatch | Technological Optimism | Why a Chair?
  • Stamps Richard Feynman | Josiah Willard Gibbs | Barbara McClintock | John von Neumann
Available ebook or paperbound Look Inside

Available ebook or paperbound

The essays can be purchased in either paperbound or ebook versions. We've take care to make it available on all major platforms. You can purchase it from Amazon in a " title="Paperbound">paperbound edition, or for their " title="Kindle Version">Kindle, Barnes & Nobles " title="Nook">Nook reader, as a " title="google books">Google Books, and soon for the iPad and iPhone from Apple's " title="iBookstore">iBookstore.

ibookstore.htm0000644000175000017500000000547411660070700012405 0ustar billbill Available at iBookstore

How to read this book on an iPad or iPhone

You must have the iBooks app installed on your device. To view the book in iTunes click on your country in the links at the bottom of this page. You can also read it on an iPad or iPhone using the Kindle App.

iTunes apps iTunes iBooks App iTunes Kindle App

To view the book in iTunes click on your country below

 

Available from iBookstore " alt="Return to main page"/> Available ebook or paperbound Return to main page
ibookstore.htm~0000644000175000017500000000532611657532562012616 0ustar billbill Available at iBookstore

How to read this book on an iPad or iPhone

You must have the iBooks app installed on your device. To view the book in iTunes click on your country in the links at the bottom of this page. You can also read it on an iPad or iPhone using the Kindle App.

iTunes apps iTunes iBooks App iTunes Kindle App

To view the book in iTunes click on your country below

 

Available from iBookstore " alt="Return to main page"/> Available ebook or paperbound Return to main page
images/0000755000175000017500000000000011660231165010752 5ustar billbillimages/junk-01.png0000644000175000017500000206563611655375534012704 0ustar billbillPNG  IHDR IDATx]w|e̶lKoZBoҕ)z XEP.v9OOO^RCJz۾;3IͶ,NgO>0ϼﻳy E+V\ /Vݨœ.]zhTTT-(?5av1 aqn +W|k+{~"@w_:5:5:5:<ĘEL:u޽OЕ*+Wlv\3hW_}ּ.fr{VTTTo<mx g>zо:huM(851ݗn n n _0uT@ - vC7V1*T\Q邀JKy4PH*222[[]hIc|Myתvn}MMMD?Y(:uh߀E׶^D?]$*r5*75nvvvv~ָG+G+Q/L5 8By6NUؓl6/^8&Dt9{]yի=}OTRrv-O$2=|FD`ӈ#ؐMbhǏi-hllߢ? pvPV,B3@&7cP*&)!U W_lU.!j*uawѭ55G\ +^n n n n & AyY`hqQL2sx8{h}|PO>;~0S!K6rqNOI3ǰTS9N*jy…@R\ʘY!Ě ½;Nx q_(H^5[0@,@n ` >80=e8OXW&~ЀCk[Mo͜"6"eF4#VG_<ѩ?U*hR2 DZrY.pa~<*73dpUuK`g  IA06aW1 i=}חkM7mZPp:>*Zr8o5%5>jDXS<A& w`I`0( &&DeTcp E  Y 4l.\XYY"٫Vި( O%ERk@`4!"Zz:낸~i^2Ok2ZWۏ;wo?n6SRR,Yr]wHvk׮-**Z7|SO=+}NtQFܴ4owY@uT[K.t_+V(((ضmk\WOk.0gΜUWkPp!ا]teN !$d4M!10 =+㡫ף W v( pT*1Dl 5wAܻWvT> |>.Z }T]`hNʚq~t?#vz'vEڊ[nERoذz]u197ޯi8yspxg Ȩ$NTUU_>77AReee͟?ĉV L,u[ @ ͐O+k:Ǯ]*++ojO qS*$Ckvl#m]ݗi_F>p{0|0 NC躗اwC8z3@-G:#G`x`x{/3>e b3bcckk;Ye`Φ`m/&'̈o 6_n#F+hz39CLC^~j1%0yDk9*]"sT CMSB4;uQ;]vWW{5ީ2 D&e LƀrI\9.YuJw&sML-ےΎl6*t 1[,E3ٹ3a1M<:)5LYH<[Z?@Mr|_܇nӆXX/[\9(bnsrWX \FJF⛺ $T+5lB Fcx5@A1ऊ&D0qtި9B c"'+.\';|JĖҗZ׃LN( @|[O]U[._q͚5z7|ҤmY~iXUUZQyuasWk]IM񨄾 ~R26lHJJos_~]]hzAAAk׮ZL);wn֭O>K/  =vB*o1FH@s,J%LB~N*?c?Pq7xc̙=\||f;|GSc+v6 ӨZ]?``"@3DG 9GD n/MsniHa3 +7bhѯa^_rE't4hcMyX܂R!kJϞv] (о|̙I&W/ץ2on E8 %U]1XO7\bԸWz,lԞMk^M`_.>6Xw;!3ofπ37EM?vFշXie=8._W0*Uaa,l<愠~mttQ7`n֪8MDEۦߔ#|8~I>Tg/4 aiZAz)SG7DyinT8xX^bwCaQ4ݩUNTV?sV؞}BR Äi4jM T!y̜CrhF'wrz/Y) &t&8:~QFMdܳs3x]jժq$:z(5QoOM H8E0m:"N$PDoԩSMf6׭[ww8p 44tȐ!T%jAn5HBBT^^~:y#M;|8?)x:u*a0R<3!Zഄﶮ< =eFpX)ɇNӊwѣG`) 'O #;-wG7y24Z DVvn󯇑g|v&㴁[@Zj* q1C(׬5z)\1,veW /^#:$ Ы&'f2FGjH-5e3/Տ5%%pt{ y>*22rܹ?s(WY]dImmW_}u0:l/@N*(itCbLS >uk]m(>Th t>ɻPc(,8[k\%&!kgGX5>;{aqC~*/ih%D藙)ؽ^} i P 0Ge؞Fw   ˎWAD@+(X 0 ` ܐg6aX][Stڈ!(93;ʶqg !!Ts6J AH*CPrI&>vxN`R vfEȠyؚ ۾{Dk>pQ]s`PCxpxmSmjBЬ Rz\#߫4 @nnI7GÀGߞ>nֻz]16Q_9j¸5O تU$UѿDθz&\4U$SBE#ةUuuuEEE,.[W_͛7o۶mz7|3x`mXgT (/$דk߶Y;uTjjrؙfPqqsd;~E۷vr9V;l1Le2Vb$0 `? .\K/Q{ٱc8y׃u}}oiӦ޽{h֭[7eʔ#G 6Y3xӝo]DÎEZ3"H5}#L0c||N[hQFFڵkjuYYj߿dɒiӦ]aǏ755BN:֭S(nڞ>^\H;X,Ы8еn Z; KQ2F_.67yUd'*# EQR5z]Aa'``y`ZDTj "(<{mkksWw^#G Bimi)+8J+p1*LmsL29wW8q p.P @@[P!@='hv\VV5˒Xbmo֖r WO新5 wq Iw'fVKP~'Qm޺uz ;%<'<0Ary[V$ؐՌYM8D>J:,̹uĭrJ.UH% k$դwؑic⼭cF |Ա^mp Qk#BOUi5D1̜VV'N;v2թ=YȈ.)A0@Ӵ  \I ݓ?XsGlw :2ך B$%iƼ͐il'Y3`kYy O>m䤗*s`B?=SQsPu B=^HQKbޣPHKbo:?R5o޼{nɒ%viZׇu^A5H е Z,uŮ];f͚wlذaɓ_|ŮZ7|矗JU/6:m6HIJjeYڬҰ˥Bt:ݦMĽ&Lm6qcƍgϞ1>xQFeddսk{_-Nuϼ]Ds2Or_QO~Bmj+++ lo1cVZ%9rEwunU馭 oFpp0GEjJR&9>jllU IDATo78H&wjޙ3ߩı3Q^hѵuqV˴?dߢG'1:9ϭCfIX|?v125=ufTĎեw+'@s&.s?E_PwtۙbqFl5O[apdrWl8,˗ =@4]6ЕMdTN7Aͩ~1Zd;מ7) W6m&:tf|`?Q`B_~epp0P9lbw]=W C}YSvW>Zҭva1:Ӳ #B7NduF1uP~P\3kXBNew<@u``>5'F(O @yZ0}u mGlnX {N}GHMMx94-A(߆ڒC u s_7ݿ>8:sЬߍ9rӦMB˩`9UGo|yЙ"-!WbBH[690Ƽ p@\ڰ( Alz,ͼ-JnjktQ5+ Ei RPSPBgvVX9u2QPzh I;h׌E(AG;i?vYRvɀlԪzV8&P d4KD*g/=x`}C=!h1ה#<d +KK3++N:AIE1w&7PxJؑI_ P J>[Ŧ cl7Kቛ/cckW䤗H'ny:TLB.Ogl  r9P @;sCIFCq8RTtPA5oL 6iD?,**zgn)Sƍ?'|Ï>hi׬Y4uT-@Z/"#lZVkEeޠGbhF"0) FXFe !{?FGG?//L:''gƌ㚚zhԩ_|E߾}}1#GJY \lIii 4Xh$,,,22W_ݾ}{SSd֬YB233jkFR*k}-`Y*ϦH3zNǮ7H42~a^y۶-a T V}\ёIYR`3h.htzs\gxHBcwU8X[T 3DžȘOg#nWst[=z?~yzzg-kKpۋ좌5|/jw9[CW 9f>aALǶ?uPaѻ) MMM.]9T EiT(lvynP~j îAϾwr+,5rӁBJ`LmoQg4,bvW +`ν;(HI`Nv+2wy!޺y͛7oܹ's̙~5 ۷o1cZ:]N,7 Z}{5dp;@k]c %+[b0`@2[ G k=v s=`+9 ? ?9.!BEKH1 B3S"3nNcfN9M 7cp&d1KX#PiLZxˋӉ MkL b`XY!8v`٭lKb5Q/0~(sC%<)B}28!4}(e:ԏuy~!rAo0RtȑK.665B:NB`8[xBtp<sp~P DVоd(QFR!.PJ86>EÒ|gT_Ϙ3\wqmi.M~1r;*3I@r|ULEs(L# $PDJCܭT[N b:_~>nv;!dժUgΜ8p/<3*_<ï#&*$XJ/{A]]ݢEK/Ӕ Ç>cj?|V+fY^dlzؐaV H$xL*Jϳ,KL`W#CBBzsuUUUJJ Bh홙K.cǎPhh:.@J~񟷋@Kb E8?1!H.[G^zŊv=++ׯ_kk+y PT߰NjkZv#ncJhgzC)뮃ieRufu$G^\<@Kk/{M lh(^-U;lYc&N Uf섐_O_ zqtVx G:>}@z++NYzCZZp{ 4F/eevFD:Q(3pC#™7r(|pUXl\S3 d@B,)O 6!oBBU]P]QFE4i҂ (Zd|`0r# 5@6] <`aM/Z(""bժU~RZW jkk333ҥK<{ョwqرc: Lvaw̾ycl1M,~Jt={t>ey(Jm 55Udnmm qK,W8C?o,A >B5]f BҥK#.wmnn4mKKklssszz~Jw=O>~xb/8%Ua=/pðϿ.dlm> R )e'!Pbqңר}^FBR$2X# Nk)LwcHrMU-5-5|WYw=o+Taֹ.Gb;gH\хl+N@Bz2Ҡ/pT3ڗqw_nPCԭW !&PhD(ǑAVVv،[ :,h j\ǺP~Bp oFHHȴit5 HcEi zP2LA.Z\ЭݚbESER -)1|bzb\XJj[nH\˴,x7q=II DwF؀.:$F;"{Ps:(wƒK87`ʊ괴G;Ia`  vVQG Z`$@]5?XJvΝF x=t"*uhS +ʔ!)`ܤQamUtVV3IiSXބ:8pAicayScuIx!nzmwp#F"=K A<-*h1ÇDuRuݍ6//>Saqhllng1-jP̨5ΗG&|-9Ujjf9Wzrz)ҧO::b$ M1#5ε-^ms 4J}"EDG]e_~⑑Ze4=]a(%@ sĄ3!qd}-)QB$SńDqTWXT ERuFAKQAݫ_ *+,[Vc ZhĮ?1=`0 /D^A=hڂ P ]*(o1 3y'N1͡=K:Ryb{i6{2@?2p W^z}GΏyyy֭[re޽;: k3Ayv dEy/w6;;zg VMOOߺuUOBŋ+**ڵ.\XaxZe] ŀ*{= bb`5LmfiĔ,uF`ᖩٳ"lKtCD}qaH`gMHd.%")]G ,JIYIYXqw| a8bY#HjgDkBBYPcWon/ˮV_zՐQ4Z8i`]J!xkKc#Eh,p`C0f{nI̸cTj}E s'dqƹ6 ~cHl={n^5lnj PÖn ]a8prɈGQRp"PqY!3:%1!^hvlMF(X^!Bw%%Ź&M @`L '\uE͝;9zKKOd`8j[vW{nٜ7߸Jy7oM6!!ҷe)**_m۶'O/7nLKKW>#G}'~׃{GqSϫ=(²ebbb"$''_x1''ܹs~J+\2QTL&Ѽj7ʴ=WyO/1Icp@ZW\B`98yAQ% dش+ !7t[oگ_2LLc|ͽzZtO?ѣǬY~K.Z*..NL6”)SA6m~}{}FK.l?{k0t6.]Zbn "a9gw;te{~ Dn ]$)U:ᐡG„ ׇU{ \J2$IyLa05:::88q&\P(WD9_{btǾyZ" twή\fF<G,J&(>,߱^uC_ծ0G,X-O<]&_رcmKb;/lVAY;܍gW;OF}oKb E8#D66^Nv^)\;0+Бo.T~ffϵsD@^;ݕM\Рȁqs`V!>l8Dzpج6!NO"#By@P윝4,GK^[ڧgVvVgc?t&]Ćֆb3?cuX-vKZL˱%%qq rf߿_./^x<3'Oh4/l<ϫTNV!Rv RgG2,)fBFw*{vvvrr28pnYr $ø_N?>2x:'+P8"3kdJB STM4͕d '77Qy}22kimGzԄ'/ڏ۷o,{瞫 <رc:`z2M MJ|y P4Ex^8w^xy|rG_&Lx~9s̜9l6GGG[ŋk4JNGZ73f̘1#pNp`Yས 'fj/W64hкuܢjZ⪧$gʔ)SL$J0?AG'U"kp_B5p: aOY,rD%~KeǐHʞd Uzڢ~\rǷzCU|&<(Dn8I"ȕ!v*'!$D1*,¯ '*DK]|s)YnaZJus{?;uh\=! NQtM]sHF/[l\\Lxw_lil֩J!ow4MwkUC c%%Ri9Kzn ӇR* tr?/_.CaS F1NlzP3TUׇMf 5t/FA2+oۤenF.PKr_cې ̊(h,"R@0g7av9r$! XUcӾVΧ?ƭ>P\!z֬YC>̴4Z^qɏW_#W:t(̶v:W:"\MrDvaB.iJ-&$;u3|yIϜ9[wJW"mg݁c(sͲ܄@ H"rƻl^?TZ3F12 ؋wKƕcYb~ٝgޙ݄)z^y dY"_pt:d21ƧGj,lk|Oai Q!IY$ -J.DT*N9wܥAg@%$D4Lhct1: :u(E}W!=O ฾塛]XÒW-!L1ȫ LA+?!zg kLLAt:]R] y{!ʇ.fOj;y mXE :?US)ҹ.9֙#3|}G㈘I9sk+q 1.>r_Py|ۂͪucRISX[~$2g͙{ub\YRZg*try$;Yoh@IB^~?s^h$0i|X(Ի,ƜYY4HRru?em|aRaĩ8I%Q%2h І}( 2cr4m x1%YмuVt~M=$F.IW_MV p(A\Pu%sX[.ϝ8q"wjM1Ͽ)SN̛`>7Bn4aބ?ec+8f! l3م1+qU)O8.&&fQef~Q!֭]n:aVV/@^ato)CWyj֭aV~Qt!D#E!܎ qd_|g{؍jBp 1[_W۶m{7~4-rJJի/=r*ճFiÜ)SrL șߵm!].0vDKxڝspͪ.(6*K؍Qwn *;SUgZ; ՞SOѐ5έR ]~](!Ԍ}z9dB=Y=hY 9s C3j.KZ65uؽqGEJ0͞I BH1pҊi!I/OYbuLe̊ Ǣfa&%ʒF'G"VZ5vQ7VW'9UAUPwa7bgK}!ς6gN.1DC9=hу6=hу60;Q6Y_nm#44ӓ5LAQt޼ 3g/s\Ca0C=CF㝷4#k鿠 B=Cq&>u|衇~Bǘ%c^9Dr0VwꪫN:. O7VF U(Qbʔ{ `I6(2I$Ƙ(rVv3a D.84bxh4EfSRR1>/???*t?q4MQMӒ$i48N@ q(,,K&c9ic0 EQ$,j(E1NvsqtN )o`" Xe&lnzhDX4Mm===]]]CӑvF|v$x:::v{[[(Zd2iZJU*;PT!22R"v,ceVR&2FPgKK0:E!dYnmm(*77:bX9RZZh"bioo$iR@>3 w\$h򶶶nĄ:EY@4=hNͶur{] G^bù.Q0^f޽'Ot݉ӦM6mZFF狈iZEY^^~ᶶ6՚bccCڳgOjjj$IL2 nu7W z#Ks%̇s]8$IRT(:uj֭z+k.2v `2A R%I޽{͛SSSg}v֭+x<^h4!dCm۶);;TVZx7L,JL嘘uuu6mr8dѣGڵkaYVhK.E^ GzA9vk4<%;6خa$}^wZn.I=24twwթ@ 0 Mv{޺YfJ$IV YUUeZssso-/>|8??l6s1fYiQYYi6_TWWlS^uUOwp8jZCjeG$l6#m۶b jii2e̙3v{uuu  ٴd E)yp8HΞ,8Qɲ 6Kד' M8e˖=z`0 f8uT||M7D`Yꫯ~/^\]]m2Du(:S[[[PPёTYY]WW7o޼n^ӛwz4M~8f!]8۷o1f@c/^B_|EKKKzz:B&99yhA;6eJb˲<|g|~?777::!d2B$*ɡ%Ibe4#GgϞMުT;w/^LEQTyytAW!]SSsy瑡/X,䰐 }eKfffZZZ$݀ ;e,QFn@Z2K1 ХdYnkkKKK#W=d >:~$|Mz&f!\.mq&Y+W\]vzJ x^an7{/<ϯ[>jppxHnMR\\l--̹|  J؉ɑ9؍>!ɸp|v :uN#]XC(3 C,BVy|v; BA( P BA( /Hz |>ӫzիW~ DQ,--moo(Ozn^x6mӦM+Vikkzsiii!}~J$]cǎ/a?xfYLo-AcŒo>BE1)))==!D2kdhH:#$=I7x"ɣ1 b$I,GFFr{c H<^3v#B`a].rkDQsFETH^Ntg(dE7e竪|+V<ϗM|/&&!JuttȲ31&3BSW41.a;`y^nڵ3f̨///={vIIɌ3o֖B&CB,[ֲ?0**jsݷo2d"(IE,''6m%%%kiiIKK#TOݻwgddO?ɓFQղ,;d$0:thFZșQ[[[WWt:RRRHOZZ G)((xV&)1ݐH͝lmm& {S]]m6YX9ĵI)uۧId Vٌ&IZ[[:("590!t/`===jdn7Y(BvD@Ln/))z'O|N:k45$/_v۷lrĉT)-(JaX233ohѱyf>N#Z{v<ϫj\iZV(daZ"""Z-8*!..yH&#{dY>yd[[ZNOOOMMrWp Q92c 2D,k2l6[MM$IaODFF`juLL2~}{kp>=x'ȣvEQ**11133ܨcǎIDF9޿Yc}|[zdq>-O3=ʲlJJ$nBȲLRxZ"vG?=$T*^hEQtmmm㼼@QYB1l"Y󥧧5IOڢ"!kYM+92:t_ CQF e$sYݔ/FQ/K9^!dY&9>j֬Y#K\(yLEu;}J1 ;&H0@ dT cž nY,w$a7~n<1L _ Lc>?8~cGCEٛ?x-j:x_g0q'z}jjng?a D6/n߶٩ ŋU`EDDszpsd5h0 -o:[雳ٳ6޵\7*,,4Fp|>_SS߿~뵔q &|h#yU]v%JbB>p~mvtZǞxjoώUgd|͐XIǧK,^0xťg75y\䂼Uk.޷_bik/xkuh*BgrWym),˚L%/zB_Df;ޥ\+{%Sr8Q Gz7 xg q˂t;,!Ns_˥e f<"0^f^{uuoس{F~jBO?f>xowŞ>{I_ϟ盕-~Iǎ ܇2;zQ޽ vعgə=$3Ϲܮ[7PU*ͩu߻|wQ)l/>iPrg`%0ēp\/9N4@8?hl!X,+]sᚕ}ن_,J,*%D#e[û&۾ᖻf;s*o) qbXRRz'KKMA)--b9%;w2EEl]=|^|i8t?2x8x6X,IIk)Bٿ<³~>"_߿dќ!fT JrT2aLweXI!ZM$!ysEGGY,!oa! yv%Ήk6>/- R40ʫPi8_g*55{$7DVnHq~])SH_Sc[On3F}E _~UZZVM0w_ )UJĴw\ɩSm3;v^}4gGΆŒJܠ111`ŞlmɋaORrc=s| ަvN!O4X c;6gzeK8Ì0LC~J8q*ԩ3 26s]s^ۓ'[%I:v]w;&"^ǟlVG4ʗ,Yl6w6mf.XO]|ZE]ۇv߯VjSmDi ׬zvn4hڬĉQ1Ƣ8n\>Gxw0RYGZmVw<~U`\v%=t}7xٹp?wƟS$Iz;wRvcn 6h>|{Ԋ~w3,0V‰|+lG{⢵k\0$nΛunȟ1랟bŊ#O6sȅnG\ndMRu77tÀ v] ̳X,$gqݖN=}]{gϞl;uz݂EVhfQ!v\nkz~?a$gOɝ^ZkJwS3XTsWll̒e+,[{ǰ ;nʺp/]4wc<-EJ]9-5g~jrr҆_XwuӦ\x^^;;%!O4X x]!,Y|Ge_SC~J8q7{֪5/:dgpz 0q446xӏ}x2! ,lxwC`ba1ƃ(*މls4BQpXe9lgCHL;G3 $#ǒ7YS}>/Ɔ~ ?(zv 5$g]56L>};&(VyEt߱_59{@Zi``Hw&[GdeMg䵊,b((%s,d-bј(ScebEuOφڈB4b (`,iʲ来QL\LV@guQa~f:MdYfcV[Ĩ$%je ~_|:0 c9ic0 X$H^6)Y*14M4-#Z1%?M鐄)$P%I $͖5m[ ;<$VF!J)աg6,RsZL84# )%ċ%x}~ z}(F#x ДTXձzIFFQlroڙ^z;L&nh4,+fv1(q˔k ,C٬mJBE1 CA$jvOFb%IJŽiZ-2<${\hv 룼 È1h44Bm#tVvtt>S21!ic"(i`Z5Cs.QK/1̪XO@}> cu'kR]6XBhIqىI]6[_#rZv3q]*35AĿB/M[57lelEEh):k ͚ČIzqu-m̍m3wvųK[uw{i%^O%NҺy-piFWfIJ֪5H GeYAj㮮VQژL.ګ k,!VKӴ,˒$uvvvvv:z$}WiyKE* |r I]=&&qFB59SZS8j|escy㗳d8VQSQ(KeZ3R2R? KhȾ1!;kR \<-'Ǥ>.^~͛7#2#J I2B ǔqpTѳ9jEƲ ϿS(7ft^T||8>tfrΨY9R@"4MQmmms`=vĄԌܥ,ZSR9cYb|qm&4_}uc%cc{DXY3ۻ9㓳YUGphg>\_Ecc#2|=N[P t]yc;m&{[Ǥ>O*2W^ 01JS(B<6o]eYkۊjsj~fn#Oh2T$/N|7A~uD^y<*ɏ_Rw(7h#Jbm5p1+!?ov!/DheI1 {(9!755<>[|w=sfMJJr9Xi($uww޽{݅IY?l+ߺrxﱀ+GŐ9(yc޽;:9dw|`׶yj5X$dFJ,rQ!Lq:RϓKT;~|jNΰ0n ި7D?o0+QR8Q>:B#D{Õ[$phe/")feY`H,MSwl?h[<;)9^"n_7èSi*KЫt>"tOif%!;!pfE2uߩ59ڮ5㣴|nwk{Fvfe$O°ڼI}i/BH2 ;!O$Y2Xx!v+I(5E1&ͣ/9IVNN124m2+RNu?ш~TDZ ct=`ۼ??v\B({qAYJhE >ҡ937 Gi]/m !|ᬟ?3 HC͹xv҉Vcݾ~:>A/J`fOM5Y)k.ը|\K;%-RSEgEf}}/ﯞjвO~pM&wc!1!ıLQnb~ IDATlN饍GᅎcYDf܃/q4Mw]Qs9 IqzaM1Y)jPG/ٰ2mrMLCIVVν ~:xXKgqI׬=30 !D$WKu*i7_.YuU=Up+zrxDME{%jP_Il!W@j# GjhlMMdm=>FNx5vI*V{K.D.55/ c?k:Ev6FDQPTVp$unkS7#=BU9J;ܺ`ITUUy~n)ԧQpo;׋1sJ+V̌0٭1qղܛi6!6b/(%AX"?yo\VO1B[o5E/ﱸ"8 Gc1 pnak`t-HG4Mn/_~`EYA—{O9sLqKk_./D_UťeU/o:RK1Xfhꏯz'8venU}3o'o=އ%EEW͐d-{mT14mFg;\Xe>3 ZgX >ƁN!VQl ?~$La7 E1̱j ػy^ELw]{{)ӅƟ;|cC*iB>UhZG:^Ion/ȉϟwgvMi S:1F*[v:}5fB( +~@yIX %}cOE3/ǀuNFr\mw35>SvezA hEH!Sk z}ZU=4I*O&Ԃ5s^8N$ߏMMi_J^nYnaz*z0!nvSde`,3g$kPPe~oe.wם??$x[Z$#YpݢaӦ.{ꞛs4ȇv7$N/Z; Ev'܁cj5iiNd޺}^˒-'ʨ !t^ޤn]pɯ|XP* JAFr}ӋjhQe${ߜW"~zRűN(;G~>Hƨ7 e㪆NPYZ1mu =Xx!v'ZKtzYW_;V1u=Xj^-N,Hr/+4ti7ϗ,b ZCew{B,)Oi#8Ƥi ^^B3?C>0H>? T;^ ,dJ32-Ȣ` 7uC BA( P B^AkN'%4%bWϵnbΦfs} BHi%")Gs *v u,9Ιfn>SB~_R4M2q_}yf?#sr}YO[ZZ(EQ m,~{oP#i4*kĂIS4)v#ǙY^Ӟꮹ)SR{`&LAa^E)P)cl2-"4ހC fL%fՂ!dбNqEIAK8> ?|3vO$]?f3y)Cb.:q`h*!Fi ސ׵Xմz,ӻm78e}m MO钙^.EIi(ZQ/>wY$$KʳwXtΒ: Y7p{U, Q) a}{YtL'OWߛ~|_3=.vm>L~9 rc^Dn9%%2S7F$I(nczyqx˯nf4!:zٵ'dM*J Q=NYee(Pe( c,IX'_q%1HK]i!>#!-pվcuQ*F 4*v5}u1;%'WWrF)1ZB%S>y@P{H1nQX{`AR Zn׼”-{ȖE(6uJe:MMjC_-> qYDA(c!d-`ṼorTb~q\/ȷo$tX;_߸P\ongRƅ.ٰψ$!,K$h.ɟftzBHO?-{zwܴ%SZȱ̜);˲$e.wX .Ip'D}-fY$cTOaً,v5, 0TlT /tڣ䞶L;梴]Lh8o 63b˼wre,Z6;ʲ,( Pt:9+[TTP]ls--9=y:;;SSS)0!BZedp`ad'$w~ȰBIb6z GRLVRYAfv{xFәT>Y| KjΗյM߬rpx5+/U>x7t.=ŅׯiWnsbMK`G-9ݾtrq$[8oXgWNMfw8B}5bbanAsoUtه~2i*Ο)*7=*u BN~t@by/|=+%Ƌgmau"Wf0|_=Q0%ǗWX~ЩJSBg*wkڦS$)J)(G("("AAD> ҤC !Ͷ;cl*xS6wܻg93Sbcr]7:wV~道[79 nC'vN"[] ͱ}g}2[yU}(T*vs1ޤ(X8 rAvEL TȅYX22?ܡ}G6nWTrѶ~'#Co0** :0te% w2feʅI7%$ әp,˄EQJJJ˳:}YIQ6kܤK&<ĕ.%h8NN U(R9n/1K>Uq9m&/0X6QB7ci-#&#șJ x l][Dpݞۺ<6[y,%{ފēi9,_Otmhwꍇ}ݧ]׾ضjÁURDV/Jƚ#&/ț^}e$N/(Қ^"gE/~ZՓoLݼgN}ܒ k¬~6k߉ |tb3aMF䬧ZD݌+ɨ=?w>p*so>3B]iK~ә7rf^Ƥk7X2󏫴$3Pּ$REN(JYnvGiDDFQdEFQdEFo(B᦬rAIaIĮ @I]' l ͻ'idž؝DQItG`#J$nBt:]vޅ-/nZ3ՙ{%<&_"N},tf#qcT?x5z*ysO=})^j@GOLSn6㜉* 5DƇАO^^_y/yi\g3-B3%Jdv,@)u\Nrl6GN3L&!ܡEq\v3N3 &h42:6gŲv;;\B׳*f,ˬ^8v؛oy.0ܕ.eȽ9@)^XO'Gf  G=PKJ0Tqq+G:3^jMprӭtmx=xikUe&^1Hԁ.,MXdIG]%E^Q ͂3s?RBdY$߳YTelv NE$D3, HX$Ip8z=Ԋ+]cV=e-Dr9;DL;v[;p8G9%#î q=-Ej /)VzBEDDo<:.ɔOWX!bgQ! tgaq1px \>U+=%ޮv+vE6[>t]b-#X H[Qk4 CO,ֵ&pp5^ckBN D%IW Uy5QP7lJSۣq*I*TQ 5<55Zo___)^@@Y oW.ee~zžr_@ E9 ]%nWu|5|Ů|Xe=UmCuk.%Yӛ ٪7Y$B?\<7 `+GL~KNX"[ B("x@ R5 ^am?___ ԁ?mI*m6~0-7[I^!"S] Ht؊+.n8n7w/"e6C?8yl` uYZLjHh=֟w;UI"e(j w$ceRs`j}u5?A__u2plv'j٫jY I$iYtzT5EiD v; /~Bv{{-?''1w]b֑ؓ+B%"@A0φ #|>LFzLG@zp?t/ / / 1:qKb3#6\ZInh$5E}reLU+*nZԑ@@{O' %(!=?,m*fe](ޛZyߨ> I^@)j/ / / 5p9Kby!b5! D]}bFΔp&zU nf+V`J@Z !wh)dȞm ƻ0@u @I%>Hc ꃈyaVjJV5Nx!D}Ql / / 7JlDDāxS=mvt$2cLtzװwbTpeERQ^ЫC=}kOj*rBdY8qvtشtr~7K "QQH( _ yuW "ID7 `[L@ޣ֑t?k# 7 =,Վ @Ɣ P[k"SZ__6urB$Ijۺ#lꋌhۦu=Yz2uF(Q>ءC4~~UIz;:[dIuN[Yl`0H: 90 vMPTqb lY{JA"'G / A;<ٶ|"' ]yl^r=:{K / / /  yJ,!$48nB !@t`*}p u;ͷԦ(r7w=)))%%寢{Z1`m[@Dg%7 C#"%@q&cO$H$}hhxhhs)%YFjgy3;B "Q@L}*?NW.X_~뭷^x?Eٳg_>### n4iҀvV_~^LLoNeށ;)B$QT_^Zd &s)sS @XdLH7I>}z3{dAp hמ҈zԾwj/,TyV<Bm{S$@QBjUe____@@.\)PsPB]2j/׳]ynwpppll,;vrtMiii(˖-[hQ||s='Iҕ ײem۶5o޼ !!aܹ`@>/~Ф.͛7BΟ?n21';zY2_&,`ﮈ5 N]S0mGb:`[JV3G((OĻ9JH %Z'H $vf_c岞K j}-cy 1^____j nBbu>?0{""ᴗҹqv4ݴiӻᄏgϞ={4hP˖-u֣G;Sk׮Ԕwƍ&M ݴiNyw"##{1Q{7~혘N>jԨD}jCOM8nk,ZYfLpEQ^~ IDAT2zKiWj$DDD+ǎIMxb֘7p`.e 77f_?)u:`*i/Q\D a.D?P5]ɂ!.G RY "P/PD""U" E "R V# j|JW *ЋV/ / / euc^p|2PDP.x}O:(rϞ=- eYl{ .]g O?̒%KS0رȑ#)ٯcǎ#pD-ӧĉ***T2'hy̚5+3339ӧ_y1{~e޼7lƫD͝7o^^X$)0L>u4?nذaȐ!K|8yd7nܜ9sJKKvl߱gϞZq~5o<&66%%ӧO>ut6iʓy@679mEnSJ?w7{ܳ>=D ;lEj>O+^Ex=1ar~@翍l7$|O" / / / U PdؑeG▚Ru  EQ?@ਨe<3?,/YѲ\٢EGo6斻蘬,TkE@b: Zyޚ7-z{oTܨ_~Eiggg0bcbh7֒^p}}G@Fl@/Mt|Sl2;c(fgg2bccoѢGy{z7ޘڜE1s5j[*`VY4Tб#_Q+ӫBtNwK&Nf,ɒl/ȶ;FCLYOú@zBHzNU! Qm6E jD_3Ug >G(;7 L)?^Θ___+*>,"9=ň|(0{*.;D6 T՞۪Ucǎ)P+VZrltt D ){z9f RSSZlMEFFBjjJV -5522jĕBH۶@M 22255eV0%%%""B;eƍwմi0=ڞ7_y,qLIY͕*5xƌgᑑ)[ƄuZ8 QuuKHH0j}h=zX~=Eܴq? vUZ%ѼP-G4+wю?|t]t:݁H*U@HwvoH2LݠW0B#ZLcMc` @ZZ^h&HTYfH: ͺ] HUdy?} e].ax-D / / /{*xl┪ːf@-W3ʉL(Z6V@ɩ"""NN5]Mϛ{FD#Accbn~Ӻu߰|n^nNniƌ LLnznNnnNǎ xw|n]VNg饗VqVɓnŸӦddL:%nt&gH|''>yu1cGc d.%"K}ݶm۲QO3uѣ""ō>uZNvvNv)SX8Aj|z1c?rvt׼ETJO>}C1-Z4ҹaIg  :IױU\2 fk^n6'Q;w>Kf;wռx :6vT#sc "1Xi,DˮLxdTLTYABaP{*Y__߇U-v:zg T잾mPuZBJNNn֬YŚL&Դ:7.]:g-?oƸqO>;u*++{yӷSgڜ9jVB{W>pO?]RRҸq; Zv-qeee ܹs'MԦMkx>׻Ef̘; 8(33m۶3gTU.z{V$_9קO5kְ7ޜ;韓ڴnØ\s1iҤmh ٌ i&۶m8p5kȻ~Ϟ=۶m/RMV]A$j7޽{M2^tLb=:3Z-%u}o~To !:Ngp:***,fJ {TzdY/%F@4>Qz6`2iQ=aUEVK# FJ?JUV!/ / / 1>\9E ";#qc9}ELbx{33fΜٱcǨnzRE]?(Js='$X$>|x&M|jnذ!##-}|!h:Ns݄{:YVBeWYI!aRTUxD__ߛrwؑqر7|IFZlr"ޤ_ T岗X܍# hT߀(t…͛k: m/@RGɁ*ã9=Ux5XMLTLУCD#bTѴ׾hXh5 0:R1elYlڢSV49'~jNn=/XK^UX]tô@KM___= Y NWuDT\6WEј  'Vsu:]QQeY튢fIv;?<Է P{K݄Y}ǐNJ(j3H1Fрk nt5F$I׏ڄ$dge*T1,FQ䢓eAONI63_J^BoX a!7,/ p;o#j@T.GiT<8Rt!/xՠEaXzBDpXO݉YzۅZԣ ~$hs#医!3Wd^(qUhԒT?4B@Tm,Wcߺ~E#e9nx-}_(-DfԝODL,zkWmo-7,߰BoX _@@BKb' U2gYns7R y]"A(ƂJRJv  Ad%D=2p/$<-jNbja#]kMeAjRFP^.$IgepO/Id)QMe߰BoX a! ]y/m8>!2GiN(]^S3S "KlCq-L0/N51+na½u7Pu4nDp2+Eh (D@oЏѽy(:Js܎ҿ1]{BoX a!7,߰@j\;wlU,+:4 =:*L[37pFYŽǵJ-z?T]wɿ#^-+; ׸q+ګpThh@F=0.h Y{+DI>t}hJQ=Y]h^'zokZ쟨-!юG=%-dTRyvk{[RѮL4Xh7Wll-e?% M@@ǟpJlJjeDҹ3OOl2,~[7I3 @NJG ?65cg , @r[?)@UW,'bM>R}jrCr70,Tf=ŔQg5Q~*s3]h^ ?p#pNoFG4HP=7C VE;i~89GM5|hUwJmGM&D фhB4!M&D]hܲ J%.Lϙ lٺmʴ-YܬYԟ^\WHJ>VUxE4S@TkWU\e<5rch"ӎj__|iU#&c9DPK#P/x< My4M)ﴼUAdSȿhhB4!M&D фhB4!M&DD W$8$$;$$$7mw#`g{_^μ?dsg0e򳓧t>e / фhB4!M&D фhu,PZ фhՊuJOi!̞ߤIkvj@Wnū5kQ7-*մy\Me]-(,j8QpA# P Nf;~!$8Qk:b{M~B~֛ue:nwLF(.)=,443b*>`W5d^մ)\\^?}gK~ޣDؤrP/g:@P5*?~)|uZ+76Ez驒~HI p¹ MX^/IUM"ʲl2Ϝ=w-_ǃ!_-Z/%S[nj%.bZ\vݘѣJKK`ICܹ(^zb6/_*6"<M(?4j>\7 1ETԣM67!s )E2aj (;޳L"MWmƂUJP: 2c$H<;1"%_'ܘپ\^57ja4t:3 $I!q㰼??˵jhhuJ6kxтeᒏ***fİ/>7  ;|tܒ?: DxB?|SSGعSPQQqG( |y |l׆ ⓞyر9 / pZ ΪeЦ9R2KĎV$dXJSګB2[Q:K2{ L;7xP#DEpKbewy \.c?yQ{MV?Nb玭zY2).P Ukd 2zk[oo/xJ&SlA^鲅"w'&4ռ<G}z95 [O4HgZgOh_bبO#Vz=!DXgoOܡ6{ae*7@Zn+/(̲lFZ&2m9٠-!j*-~=)*^}hT7Ku?.ާIKKJ;%Ϯ|K+Ə_1vCQT0F/WHheV~mo?#<֞cRE}^6ڵk^m: "" 5\g\! scOEDbCcUmivi<1N3i% R5?ͧRM^E, II{i΂t1OK-8HܹZѼ3$Z{sTd ZDCyjm֮]ݻw{i׮ݞ={!\Ĝ9srpxhj*d4I=_S2\?"ݮGtpc ?lnѢE}wܹs)ioYwm.,[VӠĉ‹ &sd%KZbט1,I5&yV: {}iQa=kA%ڻDE1U u@9%ekhn IDATaMn;|w饊v, ?I^p|RP/- @UQ[@> qol H E,:a 4 E%%:BR)plY BM{7a׋Yhmd  FX_,zEx?i \U4 ThH:ph48'_Ϟ1hjt+WZ,}GEEu9**j'NZ+Wf'\=UBC@@@@@@:iPױWnC-x$_Y'>ܜK)#$4nή盿lI 4s{ctzj\#D"z G~g2rї^J^z)qci>+HdsYEi]|fLZ)rp8iiit/nB% EeL7gOSAVoCJ_KM@@NKbf0Q(|}aKϾ/h2ekୠN%snz׼\OI!P  *+wP!99@1(0y=+46<W~7osmFgshz\f(Ze>٨"KW&;iJ:t%p$0'Z޵k׮m׮]v튊n7[kZ $$k׮ڵkNZumV#77w͚5'O2֧ٳgu4wڕa0bcc뮀7==d2q7xf}%%%Z>AK/-[߿w>`?nOzGjEy)}M=}СCFGG׿̙sI/???YfC vkyEmZ6DGE:WPR"*5Rzаh~O[g:0tmÆ &iر^ySNȐ!BEt999ƍ3o~gwvd4ƌNQP](RaŶh4~I#bG?0@^f# /JOV'mH%=LA?Yh6 3=@)eEғ tT/@h%_HHFaE$9+7|ʠЭU0ZSӳF1#۴[xUgP.\KW%;a5th۞tPq;y|LM}|СCp=۷deeɲܪU+pnCl{^z]}gϞmٲߙo./{^zEGGKwuM0׬Ys]wlDo]bbb=nݪx[SZZʮܹgy֭[wnݺ zi`ӦMڵwQ>XXM>ڶm@RRw}Ou =Ou! zϯ}оM)鯼rpOgUz?yy n+uک>Ȭ 4J011iiw͟ !+z 3 ?z`pqӀ5w$Ͳs>ȑ,;m6t*,B_+*?B >q׷N|kyj D˴͇wԩ/A &| g!܍LkC$ܹs۷fEQ~^Xnݗ_}y13_Z?)SK7n\rzE)fQQQѶm[zo.+##999ūV 4>=rDDDxdDq e#ȲRc9 u+>ojW*""TUg!)_}%X֛L&=(TaEӁ2z]Ȱ yB$I+2FP{0uIEBw[p\ԧW^;0~5Zc:VE[l},:QAF̸ܱD#Bڗ L&f!&nenj-++`mX-ҋlٲgffvqŊZ(ʬY>󲲲#G~̽hƍ/ӧ4i2k֬܇@JJԩS\.wܱjժVop²e˖Z5.kƌ_~5ks=v}ҤI֭9$B.]` .n>:s̼y:v_o'lI>Q3g/v3yg,,,ܴiSZZ(111s+aIIINcǎÇtDf׮]U7;v :v8d6\ŋ׬YӧO={)FCQ 6;v`0r-ZicC'$$0ӦMczk׮ vբ55jh޼3gΰavUZZ2|_(""{`BYO?[ou% p##3ߴq"@T`K /\+++6QDP :D\ᆀUFidbp (;"<,)ij7AM`i|f]hk/08Qg1$^̋zFq\j5ϠfÆ3fӮ5݆ O>ycM5A~R^⋛UOЛ10x 4iIkGeSf?h#pC:kw{@;#bm(vZZQQw'Q ~f 6lx@mP]3u\!;;{ѢEÆ [tɓ׮]{ܹSXb3f̐epjZ艔5sqnf-_#D'"kdU\{s \2Z)u/N|ׇj))sufM~qVV@= b1ؘ>UݶpgdRZ>Bt' d\Ȋji4*FhӚ6"@N~Ng>op:Z- J;uhId=Tiiܚ=ǪD0~NXlvGIw;F?\9G+Gx*ٳ JXJ7Laaayyy;wiG5%Fbb]V… 'Noyɓ'Ϙ1cҥ0nܸ>hٯzU݈#>otΞ={_}ڱcǑ#G`o]{8CMLk;vԬY233GyW,Xlٲ}C( 7o eڻwoLL pBѺu#Fh+;nj?̵M4aM4e>}NNNi3իW{7`JJf={V^ݪUGy}駟&L0{쪖j)iiڴis^z!={ڴiS,Z4k"Nm5t`o?]gKRjz7h֤RUqQQ@` &bKn^iI}yT~Cb}opw.}=^z͒rKskHUyUsgfY8h<O]!<~zN$€`buܹto웧q*UD}Pp,Y!9[h4 55.\@||64T,nh4lM6lٲt111XreppիvG%˲B 6Un7v񗤽OsXd%Р5>y_3^;o|[nei-Z׬YJ~>ԩSgΜl2f+ K7dY.---// 9rdՌl&K9`x-WZ L=裏!CZٕj _?MÑ#Gbz2g Yl޼yÆ <l6ͽ{ѣGk!N`0kp8u֭;~oc}=}U k֬0`d1bl^zm۶mjn9 \کxIiӯGhۅfӵisWcV76nXv;֎vMM_g|̒g[ >8qǪ20' 4!MwmZi{ j.|tVi)h57ߜ0p~dJKKq#gm–ܵCQJRZVVw6mvm{o```ӦM٫={6!w5pu E}-3s ?I:IFDfW,^U~ }pB\{MSӏPOo O80 :0`;UT͌QMq") kBS`D'{s]yR9ک[!s?t:ޢ!.Ȉ|`_fW|)mr Tq35o7mwIG@^\\͐"2͝W*ڵkwVZɲ< ,… ڵh?w^{-(((>>~Ĉ>޽{ƌ,//RLLLVVV3ŋccc}l-J۹b|Z>m߾=11d2 <9@yg<-[.^r| ƹTL f7pHJJҥfh|={ػwǏ;dVK3bn޼yذaUed8~xhhhXXb0N'[@]a~駅 =z[\ jO_?CnnyzWJ/g]tݻ7$%%lX@@@@@ZG)g]gb-PPiԣUVVzg/A'Nc*מ-=㗦ɩV7 Gv"\?fʃ@H93 X6\CtYoicygK4[*jjϒ-Վתjw 5O}III/_+< }ٻ[^^wa%XVu( /^|W ###88XaÆ UVC=t̙;w/00ts(v=;9ﮪp@j~t1+'?h=>lW[Sb:A<4rO~{9S=fmѤj!eeeTvnW `2[DU8 9lK$Y^V]U'gmʛ/`pp[Q@:mqRVE=ѱ1-5wUz:x".3v4 u9 [9MWAFN<:Ħ [jziӦFU^dYl_gƍ'%%5m'Gl:kƍ&LxOQF-\pAAwTvtFZZZddd3I`022R+9%%)))$I.b M43f $''l<~]wժU+p8ϟ-,,dҢ"VKwި6^XXXg8<裫V2&tuآ$F-ܢW3XBztΝCNɬ,bű,e:gSsIsƎa\ 9ѧ{'(YbZť)/y" |>|tL4 !qC O|rn:N9| :REGZ{X͛DֈO؏] HnԮ]yowU]ޞ^&)@@)B@P+JHG"5@:ܶ;ߏݻ-7Hy wwg;gLQ9kw wZOA:MC_#)s۷|؃@[ŚB=n:54l%/Fk>ںu+ZLիW37UV Qv3kM `4/_\Rɓ' Pr'$$߸qC$<"Ϯ(IhH7]{d{y鳳@J?rF!v;QtE{pJ2TixDAA)j )e^)>&Ŀ))))))))iiV*&ZemjA:g孼jX-VjX֬+n<ς רՂ HuTR ( ҐgjU#{Ď4k6t-ejV{K>:P V ̈dJe(ox"Ch4*tsɏ 41cFvv͛7Gg1bİa.]dZO:%oEݻ3g, Ώ`[srrz^rʰaÔa;6)))))wӧOD)tFqFjj*x1cܻw޽{GVzF+WfX,7o]6))y`vVZV)))RĶm۲mۦ.<[֭[nZ^=/***!!A>1Oj2ׯϢ߯_l]d۷o7Fq۶m0 ؅ 4 S222v%M6[ֳgݻu֎馄+j=zr| BBBj߾}tF 3,cĔ)S&LРAJ)[ӧO9r$[a׳giӦĕ+W8Nҥƍ|}}[lyXk׮jժ`vm۶Zϯy6w\3ϴm{0pHvϘ[/=/[g'BV&m۶7o9s&[v9q֬Yd0jԨ ͞=bK'T[haq)))@FV\4+WիlʫZ]w y .dx>22?g񌌌,|(>i^jU;s?l4Z<;nZö9ϱaeMte˟ iYM=lcx(=s꺱vE}Xb22ԩ8*u;5ף_oOkCB,)I]oϽE?eHL޹K /}FJBY˟t.mubܔw `>"2_k=_>_hن3ѮS}quVQ]vj )qEI7R Dvk֬|2٧Dv~}ӎ; !C :yhͮ+JHII?~l޻wobb"4i$44Zsrr VJt///\tEm>++33KtĀҽNJ;p 1D" Rtq{v 6bwMu|PnJ*jj붭Y$@ti-P0椿r=;1̉t&P1RaD^+J$OII8 2륩 [|IJ>|?f)lʦ@TVyڑ5#vmʋ#7My);cO7+^.5Ϝoټܘ`z%K;t:thT۳gǣ9l%6oҴiӇnLѢD@ D5jmVlخy,&cwX @Rr2Aȁ}=U.9lQFٲ,Y^|骗ޫӵjU-NMZ>ʃjMMHdv әS -?8u R YٖuSjSh^Q>sӿk<ۢ?}MOUs߿5)͉]g>#G޽{O2EQsI&;wRJk]z5(q7oތ1 l3<ӲeoѺ˗/ldq%7@ Js96n'7ʵ6nǩԼre0 b @ ^*aoMR>*7뷒*q[Cߡow⇏w2!_yó?8X-+@Z>cJW lu k TGbf[=tSYI xț7>-ϞKth\q)ܝ \pߩ'E RH']hMgX^|FF jm~b O 0z{uC-33MoS*[V;7 y:ΈQ#ߖmG~Q$Rh.S/^M&L8`S#E2q-lFZHS<҃4*DŒQծ^jy>-- k:v~2V&RSǭmڴiӦM,!p54Y >:¬HE (l>]eXrS&v|.[h+^ɳSSӸ1s 1t,;m;AOZ?ꛊGzlpwɯԊ4pSs&eK]مXMBŊ3@qۏ4΂ ̒<銺wєᆚGɊ@<(wN8uT Sf911?%?ʣB~8:NX dTR*޼d;bc-Cb*dJv5$NB (,4EגdSV,8[yd6+j, qP4@ QjT{Jjpg[pz /ke2M#[giNL^r,7%ȑVTsѩۯ<&F$j-Ϥ#v~=&NG8r6 uE-333+3SuO @"f Zmrrɓ5Mg9}*A`('_R^} ve)"^}'4(Q|j\fa;(+pqvMҔRۣyٖbBK^ljE @ @y{Id2L&z֩acj999۾fIIt>3`2yD@zח J9U&|Q+)5A\gAJv"%Bls~4D(Xp:V޲L&S -ZT~Ŀ'tKʦM-@dH6H_FٶX J t*'䚆`{_X*/Q Oew`H{av 0+"#Bt@x #@ ēJlrFِ J$;5 ^Z:7sj53:*%TRP+_+.D^([bIB8JJ!%A:u_z饙3g{Q<8` je@pD-k4k!  A2|)fؓd#%n0y""ň{ի @ ( .zyd;5jt_?7w xAzG$PN" *S+Z1@ ܢ(o(JBRR $$M6K.=3 7)μNi"ǥJKz 'lA"L&˛ /-&ҩU`"= @$3je}o߾s%Ūی8[$SGjl3jErH6WxN d eyj !5ԐRCjH !5Oi?5j@%oG-R#;:z ˕sVKd׊5W B 2`K, {`{UR`eE=BV; Rϰ ̜})6  SMeDd`f Jq6b`b@ ymdHwI1 ZUZYRq2تyE;ĀEjb{GYHk%65I(Vggх̃U8VH.NcԐRCjH !5MMMF`BInuj-.s/[/Z"Oj _+ D Al^9Ɔ@K{g6[eee޸y;'NHüQ|s{rN6;!WҕԬ>hĶ!G0On+sbf9@2xr!\WhL$O%ŒB8#ʾ'd PR]$Cv_vk/A8g@ҿKtIF RCjH !5ԐRCjEA$]&֨5}&vhc@ Dl\hlTp TVZjeCBϝ9YYYf/lR&B~iAlLT`.q*d~*,*;$]&2E(̼qO*M&&HtOYQ6!5ԐRCjH !5ԐR+9{͖XVgɖ3By2 zj|HH٫Z-/) 5y(eD^ T8k6Cy5xPP /6T *"NVDd&\rK!mDjH !5ԐRCjH !'Q]Fo_*b9RC :` y*Tj9T @)(?@/ (6DSEH4o aVCs  IA %HeI#H !5ԐRCjH !5$PRKk͑p"%6vB_ pl -;]RAV+[o??//U JA2$ujlwPf7$Kb7 -"~+ ]2%FBl!eSW"sR̯8CBd+Hl3" .cԐRCjH !5ԐRCjO 5AO!,mJ֜RC n S.|F@ڷY0# RjZ{.Hd  ̊Q @Az(WQ ăJ(wJi QqCr *$Y IrԐRCjH !5ԐRCjO5Jk͎ P[b=#NNJBKg^Jjl UJd7 H ~/#Mģ6mb (aSy''d|D9رc1bg mI|o OԐRCjH !5ԐR{Ik͎ P[be\I2@gf:u98/M$^:˜Sg;hM&Vkrʾ@$P`;*~_ y2Zk5F4%^+.e-<0SQ+ZCjEA-11J*aU$&&Uª$&&QyWM) 7XPiX!i-W nFK|K,+1k{)_po38Sq<@|kl96/JNDGAlrAtRT* coD P`KWp^eԫUW-V!@:qTG|&(H@Rf/ȦK*׎ڕ??lfՐk^H#S,pC a5QS&ĊE7oUpNMh-GSڱuٯf[v؏f}hPRcǜ8V"[mGrG Cmsm^am ʚTBD%G{h!hB^SUviPZѐ]r5bYK^tEac5>-*LIJjg=U9h}9ʍ csHpgF":nXnYWyJdSֽشU}O{5>+~#5؆#GOz 8{۠Ӵ2~P@?%?k9uAyAwZ񑵖gܯwg$fZ;%؆,BjUVj*78PMV.̎YK64S~t53j :nLM*E5e5[i*@kR0SkG/} %iCauqq8QʆϨ  wŲ-!33y?tq.eR E2$$9P8 8 IDATLf,??ߘ9 _lA2MWYY9ƓgXˈ*D`5 3t&Ȏ*g*fHP")>%Jњao4 sWhfե`D2{OemGM 2Bu&PSjJqZG.%[U'XsjYkyyD(2$>qƟK)kmPh1R q iuW U5A]Q5$N?o ;l;7u?ѳR'ԠȴDRa\ _rFhMCԚC2$ K)=uhN:]:vޙ;zZű:*T*l2Cxvupƍ?`q'G@)G"ZlpkuagwPT*0ԩ;fSe"Z#~=E6b3ЪqV1Qf բ=/-kMZQPY!m v8pKۥa̲Ѡ$/sWܰLjWQ[n{\yW7:5NŮ; zX'#_]- 3n`'K:v-ziT6yxۥK -^ϭ{Â?_*e(uI VkQPR4D.Q5Fm>ܫ2%%%00P[sLj!Drў$ NZQIqNOkuז蝗;j DklSBھEjTݴoVи^ `2[/ؽE[&YM)0we.YzB-̈́EI~ě)!ACz6R]>+amtDd 4O*P'$~Hח#C !PXA`@Jn2(ZDu %:fn1c޸ib3bްNoY;3OmOVDeMN@:@DYL/;3\K`IV^t{Yyapwp5^txirpjt{ ls,Sq7"@DduфBDYo3jW+Ȃ_ؽqϗ3jj~3E`!ր 6#*m /QmFKUXaydN~5tJ tX.Uj{#Q]M'{4;؜ece--}Բu@6v[qf!ψHY4&a( d:.DZ-9FdGy29%0(959@O-&a]4kν/ծBFt9.ZΐO_^./>èmyŻovLe@}ZעR 5Y)=fV+6%{(EtfaHu uD(DD$f+_fuM;?岐 *Ufhj![un[gkܹZBjV)3uNei4*Jd9{=F4Ŕ-85b_Tʳ 9gJW ^3E ؅uoVcCW;{Bk!R+z_,]zU튚%$MmCDDǾEeZ확h( '=,VAPQd6%$=:vT.j_BHaMo:ƨZ]h6ato엛ѻsxnMԟQ4i)w4lLY;JN.}_9ܮgd9dHl+[b=qN8 |j79qđvݶo]۽evoٷ{Ku`ߎ# C޲϶ٺo9|G)*WBX4-4BOHܦ63@J8 kӜ>oA89+P:w塌, ~Y%(]ﭜ{璡:z}-jHѥ@ *U8{]6mӧEcSoڑtʃI6qnIVCĵE]:Cڣn?re _b=rrw#҄9lԨHM")V kF-ܫR Ĕw鰶M:#Y8+Rk?Nw-kqѫ?w,)5DU 5cgn? x=C,nc> vk*cgA}f5n?%u }tb"+*C%`!YEJ}Cm9ȿ7sE5ֈ?ˆ;1r!jiwII`!(0]gǟ'@_}CZQktiw~ޘ LnnʅݠQRԎ̏b*|k 5G1?J kZѲrV6sI^k4\m,l#Ʈ; Z+jj'CGj@򢖏&#C'w|+j:q (ۓGTpa!cmL[ۿ-7ZKIi?kcZ)/{Ĥ\5u{CΒ~c^=j}G[kVcڼ]Lkc>wCZ6&Wj@8`p!DR}ތ0eDA# 61?d̀:fqo?I:X#FwШ~ op3)!Pf)XB(qJĔDjJV9![B II wҨٍ"g3g[?U@!(k[&nmmF 3E$Hܰ!C}t~wH-=#'ߋQ xoX`o^ӯKóQ/5)z ?l^Zch[6GyAވ6e|t:uNw.78=ih`o/ft;]TTK)̢KAj8Ӛ5*[~7MH^ZĹ( ^^ሶe}:M kս;={] ;NO:4۠ӌbK`VA~@A;˨Uj>^}<~q~}R&aZ۰am{{4Ѣ,"OeQ5C,5<-δ-}~Q/nXcro7ʅkj68=qh^:鴪Y)i9~֋J] [3Nʫe :X(Vf,[!fb5) 9`ۅr@AH50~P?=*;+7F/l\sr0g~a^zͶKձ)kJj)9.kleP˕!%IŐ?g3'-{4uhnh ZpwZ}r^̱f:g-hjzwnp]Fm7_IQ{{iGmv5V$q kS6۠W$F)-3',X}XD*RaFdj  Z~jvj1GocU,cЋu߹Z& jm4pƮ=Fg˔ 3LzB Vo=e(%mjCq%bZ6ˠ|K,"pԚXw6P]C| :M. ]N*29FdeaÝԤGamC}zM. ]z ɂUkW^f/z+*ʎڌ˗:ow~ :x_zJbަlAZĹIN T copJM2 >޺,(*MeMQ%fCYBzJZTjOYjꕃ:<Ԍ@nj k3jg9F(Z#n2}3b>Kk[Z>q=%=C˚Jjңw<k3穵"ЍxRpO ?M2jiƠ@/% -BnqzԲ@4.E E4>;{LWm91iHkFMl& n5Ӛ^=ip@LQmw|Хuӧdjh[6[Sl2yxrӹwճ|^EF}OǯjemNYkHͩˌRr)Y4{ 3]>ėeý1"ҹJ~2b(>zSA-S,z~)Yr@^U@}4Vi#sER٢rc víZRxb@>z]UX`$M} Lkz|샘@^rf7{}9P(_VQ!~J6щcşz?ha~YDS˗aaz/9ee٨*+#P79%\Eη,(*{K>ʎ=;-Z}x>^q^hո#h 8U1Dr! @y`mO`rHG%+C:/(PX0+%d.C嶏cΑƳ_WHS+e=IJF$#m>ሶX~TYa{?%b9|)~Fͩef|E7:3}z^f! {ixڷX) 5G,d]ŒpAq+8N\R9b,lb9qֹ Vu ߽YIM Z!zX΃۷˗+H(gCTĺ6Pq W\OᴬcNtR&CyulՇ hH[7o}SJo.ۘ0-teyKU%EY#SJ vh`$8&ZꂢZ jmxt%Cs3p 3W>ȯ2KYHFIEȋt !Xȣo~^  G׎1ljO~H.vm愂1jV ݗ#I澡Uhj_)A8\W M2 W'v$)Y|YHg7QHIfOMQ.3MfqO\ XMٮd+6ܦ35*czs@հGXOP1ɂ V% hZG nP[bT*U``tq NY,F^F*נ{;iA^yOʨ;X&{=Ahl/p=I$* Jx4I!}/=X{m}w@ x4FK lQrI* zX35ΜܙR,9;ٹl*|bS`5ĝ4 YrZ=Wm/~X~;_SದIa#Ff(?yB 7契=4ϰM~{Qx^0L>=UBbr2be*t^rߺjT:58f})p>:ܾE_8ް6vxi%7:=cbǯkۤ:SSBV 0U *X ujX% SQ%ˍ쯫t0k=)PN -7uum5NjגF(rc8B p6aCs4ɚ>[y˾ʇ–}>[9_,dеGc~hjЏ;xޤqx-'QP-O,KFf6}Dm=71Z4-jX⸗[r喵f.ٟaL0~Q\O4^%Ono4]wt_2f ݉3䋸yO" un~}LMOfҌ-:%}ep793fʹa N͂+kcדU1J2@&Io:6ki)]F>~^ɩs9$gkGb$.] O~Rex8>oGכ,ۘvY9N/ۘ0gVB!CfyƄŕ1mW@`Fnq&vݑ|I(ضBm-1My:+䋞 ;<5R}kΕtӧW?5oj:}b >KխYU* %*I9+,7,5|+$)MRשs̊f5ޒD|N͖ E;u&yHI깊c6?oIZ)hژ r(w@#f/]MW:$vSN\G8ryW_!OP9;vlπnv$8 {?5v%:"(r6!DSW.,<gPyʻA xCUFuiuv*l_We_#Wze IDAT>ͦi/k n4اsf όzWtoibў^D D"yIVBO,g*st W(XqA :BM>|z^CzBr3qG x`cq4lN9$W9Y'Mv 8עŷlb3oG&tX!e¤^QEڄ4qיwڷY$UY$( UYjD  $C 7tKlܞ6bQQQ<ϧ;(McV(mRoSJQT2IaRT h= eׁ]Yro}|y`3 M0k%HE#XV`j$ff2Xٮ,PBY( e,PBYO۷{2׷o۷ @8%6+.]эk^nxoZWVm" T*oooFC)Z `6WUb`fxgJK_PBY( e,PBY(ɑf'v* 0q3U ZM)eS%el1QD@Y( e,PBY( e,(Y ˗/w@ qNk"7Nˋ^KJJz B_L̩7)GOi/_`G 蟕5ӏSu#W6%jZt:Fh8c 8)J)XX,V&fT*JZWPBY( e,PBY( e=9l$?x/s~o|.۶{y׮=N$''W\\򧀀`=PI`ZF 1&VZfs`0L&JBtFbX@Ѱ/Zjj( e,PBY( e,P% rC9NcvD +ϭז߲͞eۀN.oVT99F6*~PJG_788ƍU׃=S0S"CrǦ!TjF<+`ہ86AaZeƤ,PBY( e,PBYO,˗d@BaoN7t{ =hOމ:u!Me̻F3J0J*|SժN:L_LӾci>iDZ3LT*"-e&L 9̖hQBY( e,PBY( e'J(csDQ[bVlo7<]{>}~3\aCoݺ饶o3:ڵ݌!vzvv6wbܻ?l/uϧ9RN7Pfqm8Y+f" *o@k5 ,PBY( e,PBYO,@ EBmQO=(VBkq8mHNtb,l@( e,PBY( e,P֓# DP[bۨ04`X!;aqTfXRL&%!A׳PBY( e,PBY( x,Q(-%ZVt 8*86`Z98(& x9ZS9A͖F[QBY( e,PBY( e'G,7vrt@ :`K8F^:YSQfVI%soZl6}V kQBY( e,PBY( e'J "Eao-)`FɷZ?!XP}U{ZZq@*ĢuPz*|a"kPa;Xw@,?3X+e(TUcgTvpsj)/W/I8)V]] N  0 hvkB"K~} ]O<9;n馿zC/*â`K zz02\R.tcv}#u+v.A6'H]dXP; OVfLWS A]Pk$Inwaaa.Keh.pݲ:nj&I(Juu5\RòFDo~HsN:uw23`K zz1F-yq7tkz^c–斗BW͚5k׮]tt^zn:ٱ$u=t1sM |l.Dr9c#GBvڵgϞF_TV^BOh=Gh=Gܜ˜45`H^؊{RJccc[ht:G{^WUU\3gٳw֘] Ь; Oօ uc ~e7CT]RמG2ꮋI]{N0k/|E` Q4$ID8%srMቬf.RYNjDq'PNNN^^^uu111111;vزe5kyDDDbbbTTTE-j0YYYGDD$%%!XϪcǎUTTtQdǏC -^A^uuZhQZZ_]]t:cccksrr\w[z999zmE oݺ5 IKK#!ྐྵn;11QRjTTe 9CbkeФn,]g7s.??t:۵kW`^؊hUUa ؁8ѱ%%%իD)y$IP,eu]סudBPcl 'Nnܜ:tE!Y1DnY_oN*[?3Rh@.8Yׇꩠ,xMmڴ)//OMMٺe˗_|1b ;Yf̏tFn;vի8z?P]]_YY`ῂb='>>oږ-[N6-;;;555(T{zџ|_ӦM'&&ݻwݺu |wq_a_5&Nؽ{%KB ֳgOUU:7@kܹs !}YC}(o!C"##wءz- "Io_Bp-'rt5Pˠ'|k׮;v\uUcA9a݇ )~u^>ۿA:yffffff.**@%G֭PN Jђ$lp:tѣƜ Q‡+RYw@_, d[vv~("5}khsU#ykk#@] Psg^0 UUE+h瀬1 fi\BV#aI$/?<\uU_BctpÍ7p8n&11=hѢzڈշΝۢE+WB++++++{٩S5kքA ]].Iq\P4t\ЧT[K۷۷onn ) ۷rt]5׾SODɲ 6wuܸq+V$4iܹs Ƌũ-jlD:ujzzwϙ3B8Ppkk׮۷oo߾O?}q=i$]g͚U[ nh-v5`!CB!G!dddNxH rK={ܳgر#X!eF~N}92tPT\\(7Dvm񉉉@_z5!$55uΜ9z:vXvvvnn鬮NJJ!\̊ EQzA4iP{MIIY|O?=~KBzVVVnn.<)) ,))!DEE%%%'%%eeeճgO©S8;w}sy0JX,Zĉ6矟۱cǽ{n6{?/r]Ϟ=?~^Ì 8r}ݹsc=&I… .\h X`ѣ !k֬3g!dĈ/bdddYYرcH=PUUJi֭SSS۷o ׃#꫄O?ꫯ㏟~Kܹ7ވ[dɒze˖+W\ti6mtyyy?sLdd䫯޽{wUU;Mn))) . eEEEYߑ>}۷bѢEk֬q:Gn喬,hZhe9**F#3`Xje ; OV=eEsCj}΁ [nŻvlfEH|ukW:'NOII]䓝۷L0O?x׎cnjkaZځ[5ucX7ߪmێU+oXSaaт߭sJ缺0gք!=fX'#/7*,, YeXv](22Yf:v$Iꫯ:tviӦeddhol߾}SN]bUW]u]w-Yd̙ݻwoW^e1 .2eԩS,YY/..ӟ4uԏ?8<BSRR8pw}ѣGu]ԩSooBJJJ^xEQzٳgC`?G 5lBRRRTU>|] _}Ϟ=?xIIIEEţ>SO=S͚5={vII |x[dW_=|pW^Μ9sҤIO&߿?///)) 򕗗׋-O9/--?~/_9kEҕ/*3V\{9 6lXj!6A;<<|{6@tY~ .n׮ݝ;wl?̙Ey}bEB Ӱk9ф;_)n_-ziӚOx뜗f6므۬}y?'8)h`O͆h4M$Jৠ=Dabv3+@H2AV#`Ke^ ]TdzN$rXh׮];wG5dȐ'|22260֦_~JNN.--=|p^vE9uիUUo޼yTTԩS!zWn޼{&,Jsξ}.^_t3g!v=++ =zn`zndʍ:!FGee?񏲲#G^:777&&o6:th_P;6,l[?'aӚi+v1s1lpF¯pdlj✔\VStn.`WQQceee |K/bÆ ?eppgΜ)//4 Db0`&길8b)^zzz?Eر6m?~|UUMNNNLL$4k,??_oٲ 8裏_s5gk=B)..x u$$ļZ sbb[4EQt]o۶mE:t(9///>c3g/ٳgy"wb/l_۰aÚ5knSO+))^֭['hĉ !srZhQm|1qɖ-[ !˲ 0 a@C`IɜP!sXRPYew L]sn*`׭{e˖jժo6Vx233a"|Ƙn?iZ:sW\iZ׮]?}֭['O}2tzZZ`'u];wܹ<SP缮 x!]w@Kj(TPw_IꖭSf>9cF02v̨|N7>\=S)p~\=f͕cF0 :i2l`|B(D8/[ZP> :K_*84H7Z {8ǏxCt]e5Ww1h BΝ;WX˗k߾}Ǐ'Lpm>}z̙:uMUU_yaÆ 0@zF竆U#-- )ٺuٻw/_]tYlÛ7or^y啱cݛRm۶< 8r(.+--~gؤIZj6sL޺^~~Ço\jY8a 2(>}7w\믿.[ \:Njs^{o(,,ܸqʕ+H 9Bpm><99r˖-۷9rdҥwy',jb XKoXϺծ]0~*N>}6lXdIll,xΝ׃+ӧOOJJ:ro߾ѣGϚ5~c L\ONU#Fy睄/--$_׳>GZjʕgo_~ҥ"}Ν߯_R {3gɲ,1Ñ#G233}_?O`/,Lf+g0`g׸ K,ٶm[`9FRMY!,nY~6{P(<]zd>{ s:wt{A?9/g͚ճg:tժ%I-\: %F~f!LQH- _8ڈmq 7dk l.G *:::==O> ֿRBdYWVVrd;L$XЊRUUE.x`L o=3""bi>aUUU`FۭiTUUs C!TU/Zfl6h3Zvn7\Q!NUUhu;֌9CA /:W4ȓ$l6=BHDD͚5Y2***bbbTUu0Nǟ8q*TarJ?^˰KuuS'f9zsNtإ뺦ia?vsmnZ\ݸI&<[ !𺉹].cL|"""ڷo+j^n@)Su?HBϔ톟aCB]v!Zw@~Z3aߌrR֯_`78qbk׮o Ր}32ưU7{` M|LqsS{w` ,z@0qW$P Uu]|yɖt]%pnGV#aIUn9[j=)##}}] 6S5 -څTUUUYJl.Lc!Ԡɚ1fn7/]סvaऐxXNJXFgP36g- .***N8q$gӶۃRWW U'ZQF^,ux7rg߿Yֈ\7?%ڵjHJJ:r=ȋN tsXkv bP; O֥g8 UVEL+vaf:z@"Ŋ_/d5*I9Ղo٢5wyEgvχxP( -A`E$6?>gJII_jHƖ\8 ':6hְ297.4U!Zw@, @5(1x{I`i D#f܄/&6_,d56I. X yM#(s# s^BOh=Gh=GRM6wAu0߫o:n.eh"""BUSN3 h۶iyyygxE]#!]w@?B eQS A\F215M^ p4\U 79;>剬FÒ%fGZm+{v"HСCRRɓ'322OFXR zzj48]mR.+jrZ [TTT^^t:a_=`0 M󫫫a_RyB(A3 :J\ =K08&r01X~ZKTs/I(:Rj4,Z̲JRޱcl:yɓ')AEZZקֺ6k</Pb/s%V X+/Z_ajjg fY~P(T`{nuAX{Bo^~2R[FSJaNIds *B[%[5#k+zB#?B#?5t5VB-҉ %u |a"z1;KP; V2% uYzp#0aWAQ >-M u D7`Hu8Qv@$.T$SعGh=Gh=$`59rٕ9:m1] jɧ션O .ĉR _($A{'55JUuDC*d5Y{Y^ E3^BOh=Gh=Gς|OEF0n6*x:+60]mHsP>=[w@V_(59`|>L ۢIAuX JXgn | IDATܜi0Rv CV#aIU0͕E̎s.]G@S(U{ZZ YPȻd#>mP\WW 5;  Pv;l6SD;Lu(Ȳ =yAWad56!$66ԩS9#疧1lg|%0TGh=Gh=$RnNp˨Xku⻋D|S0]m`iM}"#(|_P; OP(?j*;Ӣ E4fNi-P2ˌs%cJp=HXjܹK~~HHܔo@ ^BOh=Gh=G"hk D7a Pu,]t ݺgPaR x}`K zz(::Z4-xʼ^co?dm% k.]1]ݽ{woi|ixxx˖z}aaa$dLB,j*;25=wZMqH#28&q,\  RtFtڭ]jSURWqSz_,˄p8s"I>˂\M()8gp;S*EE,d!&N|.d! Yea,;Ni8!Zw@,Bcuc񒌱jCaeYeEQ{0fA,F e9::RjL$ɔRMdYvݲ緲 #l,1vIQdÀ,B,d! YBe2 CQp8$Ix<[w@?,B@ ܊@04Mf .0 UU,ht"&hv@VccvUp:#!PF!ۭ( 3{ p\ً(zREu`1TU\,d! YBâ^ud]2PLScMcokq! R]]ns%V0 I86M4A'i!0Q,d! YB,d! YMEP(T@v/^2eҘBj?GdYjuuUUUs^YYp8 aςv;T,d! YB,d! Yj:*(;BHQA.cL$*IH/^ j4M$BchJ$J$I}@$\@u0 Bun漛B,d! YB,d5)Vm*( cLd*IRJ*vղZdYy1+q \4h.fQJUs988YeYf:;B,d! YB,d5 B#`g%I$}S7DG SJ90D(1W'HŠR1S]BCZD,d! YB,d!IP(T;*T$*ѳ@<|}x.Teh3sY!Z!Slp%I>ÊH9WUXVF,d! YB,d!P(T`;YD$2c*eY$0@up4,+Bf1hg'PJ5M#gJl[0 YB,d! YB"(* $*IJT!nG%1¢e5Z 00ds$?TLe82Bdl .L\YB,d! YBBPThT$ILٰ$I'Qɲl\Qι톶pX1~7nH2CGbUUEV fe,d! YB,d! Yj"Q(ԅ;*gtfJ  x<R]]M)B#Z-$xrE7W #Ȳ 0 8YB,d! YB&"(* s-jVf/ၣې:8#H$Iv5McLB,d! YB,d55 B `7eҘ:98qW"# ?[nYˀ{"3$s \88Cqఠ YB,d! YB&"(*j/^x<"ߑeY8 nN-\!DUUJai[DufA"P,d! YB,d! Yj:,B t]"+Xa RsBM1׮Ø^5>I<1g,d! YB,d! Yjj, @51"ֺ3 Q$ !D41'$RJeYW)<9 B,d! YB,d5APUS 1Ƙ4%oM11f  0@}q,ˌ1ɔf{<d! YB,d! YB BPM%`(!9V_@)GFQw(s݆)81pLt]4 YB,d! YBX(*j*;I9t0 pRVcʲ y)pBnRv !Ax+EQt]WE$UUUUef ,d! YB,d! YMBD+UUUvRi3״p03cA,ˊy,d! YB,d! Yj, (5p=ԜGS2 1J4B$I 0 s:4/. $sMd! YB,d! YBPJ 4N"f\Q0& Ӂ{"$ R,d! YB,d! YjR, X5vl.IDdΝILDRk s]xq$,d! YB,d! Yj:,B! lB1pH\ 0 B#f{mns,d! YB,d! YMEP(T@u֯_wpW:眚)О (4 0KwbEQdYf!DuWLYB,d! YB&BPUM4+勯W_~ɒ%S+~ | 9PJ=$Iaaaͮpti$IB<o-˲l,d! YB,d! YBVa P5!?$O=v޽{ $ cLehCR \aeYfUWWSSlREQ0pysI$Iu]4.(,d! YB,d! Yj WQ(ԅp 6 >|{aÆWZ>H3 K?)xpF1 C$B,˒$QJ 9mcB"3]ap30,d! YB,d! YMB 6_~={합Zl)F\`1 B <ݦukƘ,˙Dz22kOםW]ye?WȢ3ؖ- ,d! YB"(*j/^]S(̜SQBc ,Wuι,˪Y m \@zl6q 'qn8o!i PLtsYE,C7ÒǏ:vH|RYUCvӡ}\lCd! YB,d! z`b 41FfG_2xHSQȲf8Yr*/Bn/+1!~˜QO?<û%%5z" YB,d! YMEP(T@ը{P܌mh+`Nι1jC)S ð̜S45!2,Yr3<Faˊp΂ nNju*mՊ0 'ZjѼ`? GwUthp+{^Ѷu P0{EmH(5|mxm߫? BHWrB,d! YBBPUS QJ)h@?5[(B)KeAa;c`\fAaj Yy\,q"VѬc}a}y#s?ulyʞ=?5Qse_?y:մoˆyyKXo~_;.`C¹SfSa/gLe-?~"ګ6d-_}'C;'ޢE ;z$0!nğM_(dNafΉ3om :Jik^r޴}^ϕukmвEKXyd! YB,d!XBTgv-|/Q2 1FQUUT=몪reY4Me_8pp#""4M꺮:0BcL$JiUUpsj,]t]Wbs{y%y^x.]*\SǕV]w_lKJJᔩwme4r_CٰqӴ=uJPڷk/mkCI6\n˖\.9^ZZɲ 6,++[)ߞźkʔ))ɩ !9l~۾Cuy 7@0n'1iRz ɷݖZZZukճ}WZZzXV⹒SSu]8n|ʖ-ɩ[~f͚|k]zG,d! YBEP(T@TzQK][C8s.I0h`f{aUUx.Yn(9Bt1kXߧ{,1f}.~uĜBBHCaF8? BHə3nOcceuqC<*V(!tϾp|suIJrvv"?+leH|lئu넎3=|H~:v} %]K蠠 0Z%Ԫ2 i/'ׯiڮ]BCvѹsgA~֭Cy$ZO`O jA֬Y'I ׮]zZO8~-Q(ڵ3,,,%egll(Ǐgjۥ%:}$I޽{S֬Y[rN2kU8 G˲嗯'Oȑ#;txʕwޙեK]w͌ui`8k_8w3{u=$" \1^uA|Oմkx(>-4 ''-okh^>ɐZ1~1VXuݜ/OSN ZՃjλcFS9?n- q MUխ۾]N;ut8EF|>ٳgx/C,74m޽Æ OMMŋgdܲeK|lܸaIعsjӱ#?GްGMzZ񨕜ԧ'zИЀ+11ޜ/0B^<_II}0_z/y䡾}oߎ~III}&Mw/11~a:߲e }c$8q"$$֭{뛜ZG9餤>?|1v˗Ǐ!! 333EZA)a'NG~nnl(Ne"|Qu]Ǒ<=iyvM1k!̈ Z` LN嶿p4c.×>{? vMdYƩ(ZzqGӧG{Ç?[䞻^j%*C }͚OuMӬV+Gk&IB6m޼aѣFW߼e˕+Wwޢ( /جi鯿-FKfM:vڴy11jժ5k猟ѽcΜ9z nrUΓiVHH_ ǎmԨڨQGmĉ\yO?]geY~wzለ-[̛7WޫVIL_ؐ!CQniC MJuYfΟo ,֭[vѥKb  ޽{ٲχ /!!1--n8UV{:vFpJaHHu]?rHF6mڸqGn冉E>۷oԩX̘֣رۣ͛G~XݧOZ`}ڷ~[p[om}ŋ?9riӧ>tS}ٶmoϜ3g^VBz lܸqf7n|6+Wb $`LHHLN>s?1OGGGOի,a.233?xnZZڴiSԍ.b/9sݛ_ iԨѮ];,Y<|؛oN2dh||Ν;~{EUZ̹s秧Ojll-u |y͛7c5|ժUk̷qܺiS:t X*Λӻ9GGǼu.^ٳώ߿ l6[nکSZa͛77::W^zO}v7>H([Tݺ5+!nc>4\kHd'ȍ$Y,-]U5UTU״"ص.wc(Fplv+?tݜ/€:+u[`o 7ui:vS$etMSUN<^CvޝR+1!OSՍ7꺞GS@Ü/Qc t^S={vnvjj؞=5Uڕ͛%IJOOTkLLUEZeռyɓjgϞݻKgnM6sϽvs.uE-~eզMO>Y6 AhNLLWv=rssQ nӦM}|(}W=z]v_V5((('''-m_LLWܹᐍes/X6mC S/{>''WoO8/~Y<_f@ K;!wRR˗/c7#GTJ/661ֵkה]Gj(6Z_mNp;_C>~[Vk@@@vvfjZ/Ņ}O F@@+++o^._Z??.''{ʔ83*nD-0 20 yWZZYYWۧOB~}7ƍ{y?~-_\Kż<B]MӲ/_Uܾ &ZFMԺp)e:X,<_nkFεw}7;;|ϗ.ZE"egg d.];w6lXLj_r2dihZ{ϝ;EFD:~_ ~Ç+Wԯ &:1fFޭu?)*nL |lܸW^%|jaP 0_'ߗX3#Y2Vo\M6_~R|V-ZzkyZjZXVş)/RTTT||B͚5Gf5j;999[l~/^jΗ4-///00e~<_`2cY?."_coUPP}^gK*nGYKe .7kUVmڴ7TUݲe/NZxYM6yg:vo\S,%/,1sc:wҳgϺu> ތ0}[l~)Xox6MQ#K[\n͚5_`Yuc \+ QPP`X^p8vû_UZAQlWi&fiӦի_V컰b߅q>SJcV+Nq}7,l6IE*jZqjŇ<'-5ڟ^t 4HA 3gϧMyeۮE1ݜ/~qq7ޘ33/'$&e_|O,]ό|:2*' DČGe/[z}$H+}]Ŕ!uIS2Əiӧy;wi9rCuzjxgvWnPk <{w[9r1ѽ[>]iN:ijڽ[*VIJ+44tUZ]nڴu֒ŵN-<|Xrv͆ѝe7 Ȳtn2kEFF?1~Z#F KI%I_NN[k)))NɓgbA:v~u/Q\.СCvH xܷo[lԩjEEE}HQ;tbEj݉Z:uڳgi۶m iQxnlbAw}~ۭ[͛7}C^o6/|m?Z)1@/ >>Rh4MC>iyNEjHan!Z>|?~߰aCu |Wf?Ug֘1cիW^ k֬i5ktMۑ#9-Mhh'((p] 5dekL/0~{gy:0/{|N@߾I܏Ƶ"""Ə#!!!E 5׍oo֕ ѣǢEpɭJuHZn-rtt`Gt={!!Z8pff̘W"<<~ 5jԳ3뭷ޔ$iҤWZzOP5k4h8aDWddk۶ݒ%;vXYe*rLL ׊!!!`4ZQFO65''{Kiq=x^ֳώ5koL$iI .9Ͽ0uvZ`z#'6jap̘13gΜ>}$IO:Z娨9zDD,-Z(g̘o1=''pȇѣyi^$iܸn4豷zcƌڴi;zF\ 5a¤iӦGF0`!CNÇ5j4~DT|晑.1Ц~[se2ӧԩڵO;t x'[o̜9m۶??{_UZ@D"0NdټySeu駌y|:jԨw}޺ukVNy*I״q=wI&6l066vժ5(=f `6a(REe>xA$|CB銢H }Ϟ= wy[o,Kf͚ԲZYf͛7F3&.%Sծ]L9f̘vСٹs't3*5k֚5kpxYsίJAKQm=<ߏŔ>}ط/eSC5g"}7n֨{ッ{;׹s璒@dd)\7b; Zϟ[pm*=z4aNNNq#t|%%={ ݛVq?oƾ0[7QZ';^ybFr;Eݣ(( _SÈ'c`LixYiy߯ZH07zkV~sĈg qD4jn\ Oɏ'I23xbIe?_sYYYo$,+.$I?| 4jfeŔaϞ=¸#2|W]_ĉ^|qѣGڶm:&3_5ٌAƍ=z EMI&8iҋGE!00U̗n+WӴ>[{m-%#߬o^y-T:OZEZEZEZEZUNZA-^a-[,zÔ3 ǔ;|a4Ox_ .} ηciMA&Mɲ+VVVNa+Wxⳳ|ծ]V:CEjhђK5s->_ 6jҤ(%)6mFl|eآE bΝ04MCg[4hРA|'(R+44/ Ӎ߽iiiiiUQxn.]κtJ(꺮K}LӲF3faqSۢ,=bN#":!-"-"-"-"-"-"-)- L3Bi麎15(Jq ƲJcl01R41\mxiµu3IHHHHHH|H (SԏW|_+|H4_zcAPUM( bmȲ,˲f+Xf .j:NEZEZEZEZEZEZEZSZAaw=ɲAuQEQdO 1&Nb$ fUUeYV"-"-"-"-"-"-"-_" ;4%`hw$ {UULEcM͈Eƈ}QUU%-"-"-"-"-"-"-M- _鰳X,R4 - Z&x5EQAeYUU"-"-"-"-"-"-"-"l;Qю8hhpLѿaGWUG7#-"-"-"-"-"-"-)- L;eM F ԛ`8)W0+[˲m>hiiiiiiiQJ}AAp: d|ľab4sE*"-"-"-"-"-"-"U Akv([[m,ˊ (fC[Ì`1 cw(˲뺮k*m6(iiiiiiihQJ(e1i(8 _EIX+M(v]<Ȳ,IR^^^jcⵢ(xOIHHHHHHH|J (S|ÎuѠFx Ơ}QA@$ xEQNix~ j -"-"-"-"-"-"-- L+*VhDQX,#4@hwt]Wb$IOm4EZEZEZEZEZEZEZA)a'I1hc=z t]GK4$azL)Iˣ\l~Q   |^v RjQT͛7)2EQE]hz~ 95eYeYUUkXeUUqN-?jJhZSDAAD(, ҶiF*A UGս{> ,1{v?gh, \Ta/`n 63] UhHs0f   CŚ5_t{|@Z" ;0V# it,EEF9oDQĀaՊm!ZyyyԮ] AAAZm,[Vol;V(C|Î#fY,t:Ѹ`늢\.\;(rl6Y1WAS%˲S/2&-OТm  TUiR 2W:ХF1&I%=x #EQdb $IUUMpN4MAAAim*Aet؉ƺ6n}$R֌1˅Kun32N -   iF 2W:vB_X n+( c,c0X,raZQAS̳rhId*AAρ^v RjUF#t`f#cU |0FC6i<#  UJ- oP${f %o0 +;sm*s4XV0<ZeZ  (*v "lv7o.g|Ї67АE < x.,kAAQ1x{ہJEDRw^xfC Z=# aŢ: JM\.}@fO&iyAAAWH릵ʾ&o+KE (R4f 8qCŢ( OϯƝ8s'iyjiH,AAATnZ@ZԪjGU_y18^tDB$IoZ1i|M])AZU1u   oo;MkUL#W"0p6M@Ow( Z4˅;UUEiH1c˥*G3GZ%S0AAQt:@ZѪԪGU_Qm:РעihACwfC[fX,ꑖhd AAQ1XΌм@ZԪZGU_v0p#э6vDءGlk&beYUUEQx/OK#rq3i5iyAAQޘz@Z*NJE>ta( 8 ]јMwhƇU]``:+, jZ{-HCR1u   |m*V1|G%I((bbujbAӃ6Y,oٜN'&Ru˲ uIC0xkxXf3VFڵ8p`z*f   ej⻽׵HZ]+sqǂ$I苦 r-YQuj)[@oiy~r.\nݺgyٳ};AAq3wH4ZZ +v|833SŚ5k=zB4?ocw]$55(((طo^HAJOOe\r}H:צ:{[Բf\r-Js33pcӓM .;{JyeUZ׵ګn[̙Ow;nȝ\PQu]nQw2)"O@Q\yoہnZªA:Nd(o0Wlb$nEQ4%I  z$A@3p ϻX,łƋ:o<~RSSSSS{|&3sĉ'feeO:{?i$4… .\ضmoRFs\6lXdɆ nnǎХK;vر: I ʣ9n8$F 97đv. 92`ɼ{nš߿zqd=b9N}-J~nf[V/m;V)*DW~Tܦ8zc|?nK9<ą f;,Y 999Çg#[].׈#NٳwvNNΡCv?~UҴ+/t={iW>'4 ;N]3 ,U:69}wlWݗf5:֢y)}tOl:u׬l< O@%D/6a?vx4[s+_ !ump|A;?p>-'TWմ8_L) |/(^Eh;MkUB#*͵tZt&X,-dY6{e4KQSU]GiyWlvjjO?֭[~',Z<{J/cլYmu={^K; *,УGܸ;RRR֮]{wkך@tt͛i† "œ9sӿG+V>rN:?CVn bH=HvT#xXsd@,LXsaќѷ4lȽ+p.k.:{(,#9\}w8s0 [:W7\`SCQmݮg g7,\پ+{"yг*qmg@$ש=ԡF`uZw>4K.,ޗ9:K2\.&ѨZ0y--xaVKU"*A௾/L. K.Aؾuyϖ)Ťs:`~<Č!E48O'z-#JA=46/Cz~~ӧϟС+W,\pp5*߹m_t 7Jã/]aÆ^zC 6mSΝ`z'h[o Uӧ>zС3g4nn+|Vffc nݺf͚29>իWAgdm:"C{=Ǐ/ADy6 eЭ-ֽu1W.hdavg*v{r\/ ]9.݅@TŨqdl c9VԷgY IDATtEw6dv.~ZV=q[6ꆋ?zi݅[ܣp|;O qwYb6\,&ߙU_P0+ QUU-((ƶiR*A[ غ0-(d\.ł;EAzv|јA?KdXN'c q^O-өտ\QU֪Uq=#w^<$l&&3ӧO|W_уG}WiiiUUuÆ ۶m{_sNhvʕ+V_~ѢE/ ݻw_|5kBCCzu;wd`1rvջwofkZjիW͉?{frrrA ]Vx"oʏs]zlS~[t)OLSO :eG;՘ryYz\îYMk ?i/y55JP;@>fPW3D2^dT/$@mV," ]T1# u=K^W Z;zdsWyeu؝meޝ?>裝Ǭ8B,YD*:Reqm*VY$ |g;czB$ Ӝ`~Du 2Du֤iZ^kN5-vE… Qv3nܸgyǍ9s R:~&>+䤟+h=3/π1hC}Eϥ1hPTAv:~5?)^Ľ^f̦ZݚUcOt,ǫۥnnLV/5wWHu~ SD,3}%,JjHʩRR^t\.15ʲkH:z0=LX1\.W4reSAZUQQ… sŏ][ثYf8u۶m> ܶmn"Jӽ{w8p p-[,66-ላ~?r1j*0EլY}iiio6c,&&ϯ.\_>C#?~:u΅ 6b`/sEZh7NKK{6loYAADѽYjV1ϥeBhcnq{ɗ*˭@ks'yWN 6n;Έ55Q"9oJ۬j($ C91h_>:Eރ$@}uzw~^`\,ULp1Z%,_@Z7U!U |vةq_O֯_K^T`.3,pa|rM+((Sx=8n_Q2Z=(ʪuCwqݻ`ٲe7ؽ{ehbb?JFpppxxxjj꯿O?4N6txYlق7o^LME'o߾|{iiiгg"/sN0;DQ\~Ν;;?O$I|I"III_n_*QV žgܟGƶ $L[/U[< 16pi kO^SQ^bDс1]M#OһnshȷF@y= C1wZﺯ[|ԩN;q@Z7UY *Ee^? z*a-TUՍE pLgjb(v]ܫr4M#0X|UUecIl-o|lm6)) uvUV9)S< 3pTXlv؍=^zܹsylaÆQ ~ի":t^+WZhѸq"hA̅.]_>99wM0agϞmذ?ܴiSs"!!!>_}٠b  *:kdyw΍+vUUm67HZVRt۰ʠfZ t:9 Ĝx"|ј)N:o|񐸹S5uZA!EwѭMΜ9[wS~5A˂?: pL4OW.QeY4-??_0uD`0iyVG᪦!:tСC)]nݺi$IBWnL`,tt]$'"zpAADŀo^v Rj"{c9cl X,6!ӣ$)­iyVAA*NJEAA|RA&:F?jʽ2egp$(5c ~chDcA0F{?`/&\ $[(07^Xqǂ$IV1O!-ѢAAAT,v Rjg"_ƋNx [Gό`]1|ShcVahpOEQQZAAAT\.mҺig}7ɉ#^ca nSܙhq-O 8{͏꺮$IiLZ啽AAuxہn^*ATi/:jg[A£8͖ccN]<  \TUU 3h&$I+K꺎3t*p6c m,ˤ9Z&S   AU5ҶiFBAaOubXt9`1~nzЄù9ѫ`S} 4HJ]w̳fZ`A 8szQwl7ozj~5\3mڴk&i M6=sV* zַ%wН:y晥KzwS 򗿜0aBn6nx=\~x-[~I&m5t_M#ϤP{㟾((TV3eM{.2Y)D hW~#WoZ=_] O׬ui~v<̫jƍ6l8Cҋs.Ydʕ6lw.Leee|AoW\ VիW+:F5gRllO_QEQNHvPY-h23zh)nPr^ҕ떯Z 57 K.=ztiii'O<{{キw޽{{Ovaʔ)o׵k;3,җT^^~׾[{u;abL&# iEcdK!J+ Ds&ҮڛP+iӦݻ5vu3o:t_.\}}>+V44=zxwGY sM^kw\Q+rȑ2O<;}=L&>ymO7V^}anʕ}5e;CD$6lؐ,wϔo_8i$bDIO}]\;Jlt +ɴm2z j2eK.۶m7?O'3QϘ1c?Ν;#7ѐe_شiSVZZcǎz}K_L&qF.8dȐ{n}]j3'3ի/_iӦ"_waÆ4O78hР0>l٥XbI'0f#Ք7t.40jB((ckLYEACb2y7xc@>+>rGu]6|dkh%6f̘{SO֭[eeeڙhʕUVg?&#,EA k$v+UvAZdQ$; 9TYDVbmzUUUU^^nٳg2ɓM["boh<vW_m۶|!ȭ;ɉƘc=vܹcƌ7o^]:X`ܹsO<į|+ݺuK'kI&XG٧OM6 2~A^F#l}54Fέw66ޜO_QEQcP\:Ae5GVdH~9Ei:_}=+/=׏|/<>su/jjjJJJJJJV\$暊zرl.a.YBs^uUue'h&^ID%q*f:_ԜVŻEKjWjYxիW~uAeeeKճgφZt|nC42}r!wʘЫW9 6lnݺ5>#F{|0|𺝟.lĈlJ|t߾}8hاDϙ3g0`W^yeI#l侚2FI(t k۲Zm)J' _zɯwݘc{E]͖41eʔkO[F2d{y뭷]O:jԨeeecǎ=묳qu vօxeO@D$\(0䝓h"4&:㤃jWjYN8{W_ݶmr>7Ϥϳ>}|>?|1x|>_(^y?-;0c{_wٿs=.mٲ^-~EE>EOE5 *P(I{C֭!SO :JKK/_g}N?7|3۷OC78hРŋˇ;pK_/ ]jy&Ɔw+(O^;ݖU4y_~VQ1g$/JwW\_!=c&M4iҤYaSL(au81F6 " Ոy^6m\lPPYDHi|.Q<7n?x`ݺu:t矟d#Gw}|G3FO8ᄗ^z;, tй۲ܳgO?>jC9L>/'tI?q'p‹/x#◿.^Y_WA0ps9g>~'^sy駟|^z='hN:9sL<N9)> As4`5gRllOĉ0[EQEQ:\>w֭#TV3ή IDATeM Ufy65޲|g]n8#w',ɵhc:8΃lH9we0 D "`y㼞*eUUUmٲeذ#mԴ|lʯ쒆fREQEQҥݷ#TV3eWoR_~{;w5k.]zwp@g}~NNEiM_y)ys_?M}_ٖZ8w@5SRfzD^J({cn#K#n0?QGQEQEQ$ҡTVsdTRN!7VpQL GcDI@.Ht+ lH>QdAe_Be'Yjۛ[>S-((Jyv_V+N4Et;fN EU~!0qM^P\<\9WL]oo!=44u*(Dq)KQD1y1Q7 Zšt{0.#r(/ d٥((( 6vPY-kO.EttDňJoZ`?,{Z9KKՙj'Zg)((*ke SNCgXi"smBVS%eTI:[k]y^&8 @&NdREQEQ@~wܵj֘aҙ,;3)$ (: 1Fr0sR#%<9E A IUV;en(((Jk,!q#զt:NzEO1s\.ϗHOrqlyW4kM0 1կړ,ˡ(((AbkZt*)i vWN+C*fQ Ho&s(#NdIEQEQEQZ2yq)KQ30U?✚I>"J,>"F1Fa(!XPYDEQEQkLY{h:)J؜qO7O?{ܸq\SECK]&7$BlΓ{8rΉ3pz!Qd\Zeό(((3*7qE)O*j9~/Pfk-N*iD0hB}k \.gfHe,wۢSIQEQEQBAB);Ae5SVN%EQ\Vh O"]Z뾨P$|>OD[o5QmDT(d5dc7cNd1VUEQEQ!/vPY͔3NQfLݦ /|gޛ̞K?@*+~vQLιB3{'%oL\b^&I:}?H1&HlVYLVUEQEQ,kRFN9|15X̬?2r%_]կ~էOҘ.ݻw}\EYf 2$ 8GI䦽s;\.A9 { @DɥDYk BYYʦ2#HtfYx׺{{-G뮻3gGix`/1#-֭߿x%}H="% Q"1UZTR b7XAډ,眆*((J1q)kwg(Sa~[]|_ݼu.C cv]eРAxÆ ttA6lh~__tEzٳg6~ꕞ`]m,-A.[^III&|>_YY)״E&.ĉ&HIO'TYGVCBQEQEQTnSSJQ:+Vn^7Яϊ>QݻG /qrU#}IWXx5'ܣG뮻NZ9g}g͚5nܸuՕ`#ȍXkEd2ykHq%bZ IEi Ŷ}=+/=׏|/<>suz\s5W_}رcsϽꪫ6nܸq+kꫯN2嗿˖-j5"g}/_`ݱ?FjeYe*,νQ ~rbbch:yDv#KzEQEQkEiY=K/}ⲹszwqMzǎV<Q4l)81/3Aql`\Z+JMߦ='-Sډ,۔٫(((J3*Za)JĐcǜ<8__ԡtʔ)SLib{r}.[L;T p 7p ^>sPH4(#km&r1$ (pD%QZ%%%%IjW@QEQEQVA 7A*9RNHnSd{ W0 %V4(l6[SS#y4EYk#ndK!N1F.dTV{(((J+ ;Ae힬֛d9D_kN}? Tk`AƂ>nf QTVk݉(((cZ[^^A*9Zw)Og1إqW >/&N)/D,++K΂TU*$*OeYUUU-9EQEQEi=q*9EiY:QbHQ=('`R7UX%aA NSI4z*]3KQEQEQZ:Ae,EQZb-CD+a$dn5559' l6ɸjWS((}# &tCh%}眨GI0TIRr1] *9E#M(((D^;jᙤ(N8ds@4A uEJ P P(06)ڕ=4EQEQEITnRe,v5q1ˉV6SRR" I`DQ& %; Ƙl6KD||ߗ뫬 K:4SEQEQLAdَvPY͔jLQ: |Ad27͊V"* |>/{ayj`L&#TV{3NQEQEQ:{Aeq7Y$^w%8 =cLa}_Y\N6(Nթډ,cL&ii(((qkLY6YT>sBP(.}R_;DC 2آ<ϓHړ,a(((Tj ({5v~z}Ǎ|yI{W7dO@6 :%Q7@DIOU(d#Bv!Zf,^*"9P) 7m. 6@4 ɝ&[<4E`1!`DXY` r8d@ϔ8&"0Y93MCkz R^#ADk\86 ffrβw̴2p$<3&r2U0)kem|c=,3`e^W{CVEQEKCy#KQO*j9~/Pf|\HLpqk#zGuy'r `d2Kо]/WVYM֞]{T 10`\ 4!ZDd4' Z@K(<6 L\ aCg#WeKqH>3SXGDDGD[#PP(6/e6۵ͶdPEQEp0Sz p#kO/Edc `w|~=z8ġ_Kƶ>lV8D)G-$,?QFrD۸hH}i<}ߗ;dnϞS- Bnˇ5Y\>BXs 3R'Yf4 #:4=CPqfks{`lC`g *H\.3!3 -A`dc"@!;06|p,@0Hy!;`B\InpTF)<&31Gq̌CF*ٰ0iiICҁvzjeIIId2Ç=?,//۷oz圛4iR޽;J˦NyG/첺B T})$3A>_0 E A$; EdKIRB UVUhW䶭޺oϗ1C60&""C$$[d1c 1 !AH0B\Hr)kB\PM!TA A C0砆&Ě,%Aua ̥Jl l ` ` l IK5X&j95c&fG0΁ B怈˭A6L ABϠE0b$].0`G@ Kn]cLŃr5O6؊s%r|= _%Kz(|1mY;eÎÏzs2K^yk֌:GLiZsyg{g ,nbʕ|''OhѢŋw'?ĉ|SN)//3f̌3{챿M$ӌ(1g_ޅBAs Md B&by7˺]*X'3L>gfډ,Dl9(\`P ^{m&ӧO3gN޽;C}ʔ)wyW|0̜9sȑo֌3ϟ_^A1FvY(B ʋ(Z^rj"h1痋ة#TYDV؀e{ Pv><.brb @qWsE "3 3#ŲM DlYRI8CMD|d l aNČ` m` zu=@Bb XFh1X&G6 9F)AfDbdD|c QHx"1!3882dB*W|S'gkg' <#֭;.#GJm~ VUU\`a .|G?ѣG7Nӟ;^xw9a„>}4]PXkE8 2L\G-VR4<2ȴeqN'9PYIVS&HPeE嚹P7'A؅Ѿ'D"3KXG[% ` yR2Ke e..9]f1)}j6/9ߗ-'AznޓW^y***M6m4ykٲe7|+0ܶm3<3s̴?yŪUD-ܲlٲ ~\s͂ |MMꊊtz…|W^QEQewkd)^L񗪛{7vZ,57|dGׯo߾+W5k֤M;hE}QGm۶?O>vؔ)S>,^x((_vPY͕(JKQOײG?0x%?k2e 3_uUI^:~wOTUU]xӦM;=3fkVZFM/˓";'tIkܸqݺu;.bn(u„ K/]`A8#59w„ ƍ[paO~>)WVEQ9t䵃mY{|z)J' _zɯwݘc{E]͖춇m֣G :NJӟ5_zYYرc:,|Wxpg^x&Lhk裏nȺ8 QL+'c3l5P{(2fv B Gbd+6.3eSd+I}RfEֽڗ(K DD[kg"fp;j_hrdv{":c˚%"2!sG./,A! 9v r=Y P/yWfD`(}LT#uHcQXYF&Et6m쳏Rim&'N\QQ /y\p/yK`;~'DMqзoɝ M((k۲l)^JsFr6~~,~&/KJJ{{L^^wur`4iҤIg%݄nnqA~2/ 782Qq6 - CL%Hv$TV˂d킚U}Z8FR;!v z2==d@Ly5WǶ- #8@0*ya_xu_ &D4@cѠ )Yda_&ߺ)Dc0dS#Ižu;RѲX0z`Т14s4-#΄@IJA f`d]zӢ?>z򲼼rƌݻw/9pk׮}.\8o޼|pԨQYy^RRR0>31I&օ޽֭[׭[/} ֭[=zHvשWEQEiYЅaVXkLY,Ojqi_ԍ<ϫq%#yI~b$9-=XeYgW >ycfvNb6}431qUccSѳ Ux`9h䬝*ǽ$3bF@@@$dc,3#qX>2 d `%qs1Pkwr>ExEAqXfvq ,@qØ\r>?t_Rlj'0;,X $Rz=7|sڴiƍ{7&O<`wDtĉO9A͛7/;,X0sLHot.]~xk6!C$'y^n݊6l؜9s|Ećz¬((mtĵj,EQZz#ItD싷0>J;3'rV jjtE0O_!chj00&rsbbCD#9$-0>Ad`-M$&dp<H2]Fn|mN`Cgz9Ǻ]Z  \1/*ѐ2Zr{]r# (AqdHmF3 vLqbz$(fa@DFD6b )#8 " DqL$Z]~iFSRRra]wuW\qE8tЛniРA/Op w^>}1ݻw?3.rykȐ!7|1=z8묳 Z/)B>;c~%ᄒWWcs߿o~#Fdْ?׿PEQ t赃j6pW.lދ+f. r ,9&Kz Sˁ%rYծd9A~GƷl,rY@qMSťl˝F[[mp!"5 ێYXyKB,sDǹPCمK_*[ↈ? CdLz`d_|J򸝟Y|AN^296ecZvj/5,/Q輒 j!FfZ3I4uȑ#GY=^|_|qgwqw\m<%O)H"Okۉj NI "RڂґeS LOiQ؟hTK!Cڭ~E@D%- $6?1~%/Y}plYqEQEQ$^:Ae5GVk4E t]>$D$*& Ƙ0 0 EOJopZD_)M`kx03ÀK"a%:`d3q)R `b1CJıbZtrMǑ˞u1b(Pr}$:%JaH-Q`8FMI?8ZjSw(Ur%]"8Gŗ0r/bK4:)ۢ13q9"ވX1`-[ּdW?(({l_;ݓ(J YTL& ί)nh|/.Mmm侔Ex @6b?(*jgVfu) \xI&U&Y eœn+<\mҀcv j"~TtJmq.@|Ir:qY_[kB^JHGD#$椆8rtHiFJi>(5]lCq@."D삭 7((W*ke4SNBgQ7Ĺ7L&#)c7BA6 =kL%N(;Nd6McbUY Dd!b- #rb0E"',HDh1ZCDfG` Cd#&D&468tL@llزED2j@B@0Շ*fl##HZD@GD FC⒇rLHQ HLo2lD {aH";r2-!qmLdcm+{;g((JTVsdRNDg1Ykl60" P~}O6 ąXtd?A)(5yڏd!1;LrC`dD `e$Q%rTV;e6JP(š(  B1eyC6Hq5$\R=%Wp9 {;8̈0B!Y/#[p!c!$z2&1ԤҢ6##c3Fb9ĝ瘸cT;Dď$"&"a CD,%= ~o|^(lWEQEٛt)E(! ߙ;1ʊ]GDTql6qIG"Zl#;@ L(A+(Ek۲Zy)^ON9|15X̬?2rإS~f2ÇҞNNtM4weeew^ee%\veSNM<裗]vY]u%z!5Bza/>aJ8c\ZE.ht>%Q*ʪwJijjj2PRz9qR 1u1!X0 _ȗ*G8N&5RĒe`( PCr01#8  C@R!;f`"s^PɆAg I #Hu]2@)%3sl5ɧ#6GgRqHDD!3@`'q(alѰ Bvs#"j`((J'TnSSJQ:+u v^G\j|u!ʻo,d?]fɧrٍ_kΜ9ږ-[:KM7TQQrwy_N:OqM>Be7YmB>${okpgE%*BdX\l@(p'`篌#aO)L1s(QPP \'RȖ Z4撃6^2җB&;oQbG.1藊 9k aH.:\Hwsνyeg htLM&. ?31Q5II֚Y?㬥u||H"Dy@ӀqΩG{Mw9uUk[vMdLdfDfF"~/b1bĈ#F3wiuVOK[uZy*YƑGYƚI&|pȐ!0o޼{_lif,X?yرps9>O<̙3׮]㏯Zq )To f/aE{(9 뺮Vuy?Vt ~ʉ(_ဈg/~BQ [  7^:U33zQ>HqJ:RG;6J`t0Gd}0?)>f~x;3"b$nG,7tS'~_@_G=G.]̜(o:ۏfwe0#D#=?XF_PJ=>ĺE>+ԓ {ViňYG{c cGl۲H{f}[qaȑ۷okǡ(KQI7U? IDATeyeUp R mXm( D"e혋!~({w0!FpB^_` # YpbIkBKΧ.T+e" 2 !Di(!P"5؀Bn΢`e\,=ᄏzݺu<̍ }R~xa+b/ғ 'n;rwiuVWd&F(5 jH]um1I'#v`wu] ,`;#*w7?&Lشi?tzܹfϞ3gʕ+$ӵTA6o]-ij6aRb!Nd* XH[1ƞBĴ-{^)*( M, B$@05 b WV كCIa&J*G |$bPDnH Cr` Zue cWAmA$L{ZB@0 LLZk{uu 30+!QZkD)%1B!@`2DTdDbE%5X$"r(a lX/E g 9҄:$ sm@ΡΆjA(tR: W aJ~6z)@IIL^ɑN?~\)5cƌ_~fw5nܸ&u+Fx2̥^7773a.r蠜tj{Ydٳ:,_f͚t:4uԎs4hо}{o}[Gnkkx7կ~uu 4m…7tS4h՞l6O\zŅ%f8WdWdS\_xᅛ6msŋ?q]{u7hmm]xq]]]SSS*nY}Yq ڞzܴs8;5*{شiӒ%K `o 11it˕O^Owr9&/J;ȶUSLD ?bZ]SR#ɂR3"~{ߙ8_nD=O0ᬳκKG^xe]Jo~_[oo={6\s5sν:Hh޼yw^qJ`t(ut@tבD.G-\;RXD2ĴNmyv'|:n7EKC\9d=g:|cArA%3KN#'Fx>v(5S#B䔛%'i@@ACX&Ɯ#%|BWx3PVTs8 (tܜ,D嘔7^:ʸ|ySV ɜds<ՀHyXAÆ0HqHJ)%%vJȠ: WxEVBr9{ lKHC@j2W1f3gδKӦM뮻Nlٲzkk477_ve͛5ks=Wbj??;㢋.*NONo馦>r~__y啖|;ŏ?uw^x\PB+VL4[o-wphllܹs'ܹS)e?o߾ƅ('=y[mۊCF=,˧O%*,6cǹ""3ǜrҵsښ\rɝwy9DvNk֬?˗x.r„*S0cƌ뮻xjV\=r-%\7X't0;Hk j H;> [|j(NhĺK>+;jJ bZ#gpߜswX[h׮W.ݱ'{,۷?aT.cǎ y睯c};߉;yO~rȑjjj,8ͶT 1MVY$e@(ʄkz y!.dJEd6DqfJ-KP8TB/T۶m]f+Ͼⵯn7l\diۿ9wC5j 8 :QsK@ݮ9*R< u"t}-[joaÆ9~;vܹ1^nN;M)uggԝ5k8SN-xV{ .p]wʔ)>n՞ڳgϞ={f͚UB[}Jʍ;v;wwyvKm6,'=eʔbTiӦ)"DGj3V{+2Pq+2S\:ue˖C !Nt7 RǏ3Rݻ([ *M]81ct[qv:_U+Z#\-W>UMEI'4y?Rb|VtB:W;ĴB+F݈+/|W8шNp*#!Dt` eD=B2۸u'iZF(%$c,mȔ@HY,DカM=A`VNEOl&&`];B $~.sDPk60FI)wH}ASu8lչN#+y"#Pʠ' }r]By+$Y0̦",~E 4`-}`;O Қ$)1$;%PN\ۿwYׇ:39,R9JɁ'r݄O:*sxdw=M BrRM][4g Jf$!  +lHP20#TE3ycΝ;_x;٬๮fm͊w^3LCC\}Ջ-z'_ȑ#+ҭ]-ɬ]v%DT{gķ X|Wrr-/j/1顇}^{mEңG>x`:nii7n\nV;bfXnf0VdNqv kd>9NK)k.b„JSjD9*o WjtbVk#t˕OmUSr9M_XuP> QF:OzZ{bZ#FE !DPpRފPd؜MDZmZSz DH |2U%Q_yQ6F)ۙHD@2M $ɋZ?rx᏷~Ove[oHzo1 xI C  A 2ڙ ! DdvZ)_"m{@lvv|#\@)\GJn}vj;TA iL 0z䘡cJuS r PH l @@.w'0nEb5kq0t!Q(QTEFCf6F!d M\y'J(&@,W 8qbuI$a:Aũb!\s5k֬y嗯Ja 7n\pa8=䓓'O>`tT{jҥ_|qIjHRvNKRJr)k׮5jy#FXz#v9iDtQH$Q)|rw2 {>.c0?[Rs$HL-#Ě|nSOW; BV`+=\&LRP ??0D"aeN ?h9{_.+LNy[y5+^oDA2%"`w1fYl`Y 331m`>Sxۦth:Tn@R6{w~}x//uö6?YKDžqߜ|#M0hp$Q;(  @"rEN3f3d@&XHR"Z3 c d B!*Dؾ}f͚(Owcc֭[hӦM̊{nKKKkk+,XB$~i&F&O;h_{oWZeoiM07ߌnlUdxʔ)ׯ/vĵ}|Æ Ƙbff5jbkRLWvJx;p_my^zIk})Sx.r¬cn޼yϞ=?pWB? UVE|vjs}ETlN`vpv]lvS;BtB-#%-Yn,upf;Ĵ:M/FN;.xZ+o6:yPJY?a[h?[-Y& Z|ߏiZEW @d 8 3@oydZEHDl@E-' m;h @$J8}ZNlݻ卖]mmn9qRR%:F .g'0?_ONhoa"DzIOm,4)}@=v$4,ȉ0q13xXt@6@IpFQ(@{![_C@A1& u\@CbRg%9I!sQH@B@rh.Gfi#7;]NJ9z/˶ _O?ώ?ꫯQh^ze̙sW~`inn^jE]V|cQ}LWvJx[x]  U'x/~>v}QN[ ".䒅 r([eq/8*&SH+rU"y<"=ԮP|*tG(N~ĺE>+-:D"1.:#dl4ezosҝhjzϞ'gqرcgϞ31sơ/"Z}d]7Qk"ZC֌N챃֞T8eŽi:-cL[gyF o=&xV>h (H%TƠbJ% rJd|Kg T2︎Rd')M~_4 (l|5CBE08tx?}k>ڵ*=jq9@&'&uNJ>n=TZ%9Q95U"u  Ӟt!Mzi`AY33#(!KI|yƌ=+1N hÆ 7n7ѕv>åK~&bĈ?dɒ/Owywq"_|k)@"K.WXG?G 1zζEZY +n0 dsj"{n P)@DVAѥEeV&%ʴVߡ1v%6=GL5HL4,X?"A 6, c rĀܐɓA}0O'¤aSGrޑe:Kˌ, k~3.r};7n7zoᓯbjq pE}ғ:麞 pBH @)`vRB1k9Bjc G-[7[>0fiM[5FEGF w| N A<;Ypn&(Hϥ0d@9p] `&C!P)!%fC-H!a2,}-[a8j(ߪ+XpaS1>(OÈOwiuV&Fp0ž."ۚ{ wP?CRjfiZ\daa~踡p ` hP#3# bF4V9>tP*d!|WA p,%JĠ!:mmyuӦu-;raäߠqAF9@Uʣg)OgsR2k8Ģ \ K6ۇN9om:xi$ @N 5[e#00 ȁvLd8?>1d6Zٴ$8 XRBb@2'NɃyZ1 *^2I'Ɖ"1:#Ɇ`8,J>Ed 3Ogk,:j.#K0!2R 뇎d f&&m÷*1^H(`S˶{B O:h$T\*U&dB vϹD쪺ԨylzouY1aYN= Ԡa7c0Ԇ4$d!bP@{ 5D9uΆĮcvd>ooٳ]:u%~v& $׍VѮ RJ9}m{:h*) Y!df@'ffcBPȤ i"(p1bĈ#FG;ĴB+F݈`J){`Cٜ֢ MUJ, JV&D7ǴbRni\%]fDB2 $ A$famAhȄ\Rs6_˶> :jL-Δͥ2Q"x pםwe]^rϲ&zgX6}pP -@ˀ= / A)LV_'7^ݥm>kz:00I'@PJ28!]W=yˎCaəSg * R2kC䶈 36!2!KEP  ٬ 11bĈ#FDܯ1AAId&AD"aU7/Tk"F lM(xGA$h"Ghy^a6&(D& FV"3# 3K 6o#3ĎR!&}2Y7niۻD•FsXtCX`Lp4>xeUw%BiDhPHOg'\lVXd-aj}YB-]2'@Ǫ̒: IDAT!Πи +l1xcS:YY8:*13.ۼY1 7NL0!Gu`#SCFeZ{w6_ۿ< 7ɺؗp~9Ȧs*K92ԐM MhHH`mHȇ0 B+P $m֋8D1bĈ@9ǽCLzUb `]Qo:=rLεyU.Xt?{[ё=I ( C{`CrZ`ێS,[WȀ8l$" {U6 $m?0Ff0,Ԟ\{6PEP. pn4k0wߋҐED y'2`ZDk#SC/u?y_^}ڨS'Ml;ÆطIÃ6n] ̜sr&!K=7+x@CJٰ HgXv A "͞Q``2(H f!%# !0r@0#F1bĈ_gǽCLzEb /)׮x'fu\@k!)Xέ1նG]GPȚTȍSl-.fb0!̌,H022`"3W'o8$&$ #Y20ZVsqfB`HH(QHCPS7:A%߸t93%}u P{g̞ p2 pRA0D DL Іe+KtH9,@׹t $0' f  NK0뺮s4B6]0W'z݀x*8qr @uO1S?bZ]#FnDsٿ||`+<{r%5G繮ֳIA=:0(״w e꛴Q̎ Ǡ6&T0_Hذ4Bc`e4B wI-6Ta )?F!EIb @+ #P "!8o­^đRɏu s N+ٛ3{\vJ09 HH$$eL  " !_)Je)CrSلʸ c\0;"YHHpJ:,s9@"tfDF* k)^ 0<裏v ]iW1wK/-ETv׸&Zs17;}a{@D @xU_C(ÎSHG6nqt]0bZ#FEuEDBH% (\}'blϣjP!="UC\t!.ڍ rSJ)[Ǵ0 ECJļ\ 6,J(@ tЎÆ\HfPv@@[lCEd7#hKБQCvПW.y԰qmz}Nf}a9 S " 4TH A$Dy';`_Nf.Y?onC}"Z'Vֽ܄ȖC{6bkqP C ZtL\ԀíveF[{QaXz@tEjNڴsDr֍/e7qR!K":^PeR0 S) ADF"C@Ċ0)\DwLu/kjjJR/^7k<ff6l_>vX{?mvyjm#jm_|5ktf-ڿY.]Z/K6mnn޵k׸q㚚dZ&K+v$BFϟnڴ)2W ֶp›nڃQw5;-ٳdɒ'ٳguY?9s tС'|YKx*kT[[SO=~UWM|WۣQWFVUY.6Dx!EZ=(h1blG!m0|HI!._y]-[rʶ~7|-~۷[nҥQ뭷֬Yo߾d2//_G}'x`{yZaQ^{D _:DT wq:1>Eܞ8(@! d봊 Ȁ XL&]'64#H7vяLks.9 ʀt-C'jݼzKϙMNte T)o݋ &s=&XS;Vܺv`&<J!$GQo*֬Ys 7˗/%˗/Ks9'477_ve͛5ks=AyjmF:馛mɊ+&Mt뭷Vs%(K/4mڴkԩ˖-Qh믷-YŎDHCCܹs?'OuVضm[cccm(ix̟wqE]dߡ&Mھ};رÚ:dqgj3f̸T[NvX|ӿﷴ`|"tp -ʅ6B5mmm[G-c֯_?sr~nllܹs'ܹS)e?o߾SO_+P(lQNfFGX @E\eX"~̎l;vE'+Qs%PUYLg`41>l;@(qp}njSWW7o޼kG_2`;vlCCýSOO<ď~?x yBf1qݵ\ol?BJu=ϓRQ" 6%= F:+huDBN /:"@@,HD,fCl@`f@B ~7nz75D)/D۞lvd|7 ! :Pzਿ9\'C`HRhbe|kӛom~{?bSkF@DF)ٺ5 >\pJ-.lٲeСBS~p;vعsgccctRkVl6f͚8ԩS#֭[>lԬY:ؗm۶~BӧoٲF!6lꪫ:jL:u)S=X%o<ӔRgy0iҤ;v@LLڵ33fLUưc֭ӦMSJ۶Y-5B[IE==R6/~%K"~nlls;mf vǻ`OH|-?[Qآ WV V+1^2,NTYf)Om۶>rF@ +Qѫ!CLӴzDb8Pm@! iv( b?R)+ZZZE(E{iӦXs1bܹs1bD Ն"L;!":̾en !}? Cq"';Zk)e* }IE1>B+L!`Zޙ @"NP'+DQ!CYYWG^Cm7Ô}@8AgGnaLY>:ऌi@)0A ]ѻ6Ƚ.RH^Ȅ3Ojt3!)4FFG zRfY[d>9W_}E|I)_?rȨ(=ޯXbH$JJ-Cs̉~oРA7o-"~)Q:\1s;VY?}VAĴ§_Zyf쫑h"O,Q5 Z댟C鸉zL9M}"6Z&aJ&^+ڥ$8G$yc,@Cn "fM FrdQd&?}K/޾})SlIcchom {=!D"(VƊ5+y= iUڀ^qruz4y-Wվ-QW^}CLӴWbĈQyQ .sw &444̛7/b??.={vi?O[ogϞ \s͖-[nGy#͛wy絷WƷZɪa&{|Ցڲk:"?'dB猔L9Iy"{T260(!'\SO@|  %I:DoNC]tLB =p39U;z/10 6& D qMPD А %0kY!lNJd( UZk:rA| _⣏>:p&[/|aŻv2dHTxW`qj5+y={E^}ՙ3gV cZ/O?>;~F"^z˖-3gNŎDH ƎKD>68_|qG+|glqtFTd8T֞K.d…\qNF9ϵڷ=ʋ;mwiuV1[?8it׿vE_窫hjzϞ'gqرcgϞriȺ+lO3R@p9_Jij7DLf9#r)cQ>:TXRe v0*0H6x&D-CEᑽ_qpHۚ Sv ;zۖ5|jہg\?=ĽԀ$#0,c3tO נI(ila:oo7"z?Un73uIϘ6^iA(b-p`KBIAe]) HdC@ @ٌ_W?xOWf̘+ 6lܸ_}|K.یĨ~'Esxcɒ%_~yq#T'pztcXv]{Vi \sMTGXt߿bŊ>w>zgKcuX;6?iYg5X0߿~nR~a1PaBBtt飒?1 ޿¶ꃴر@DS|ğr`3P%!"{ŧrFhQ`!"*B @R֡`}-[a8jԨj .\X#`>=MTz+t$GG2 !~wiuV1'=s"9p:Vz'ڱ\m[*h@DdbD|n.56 HlaJAWhz1"VB ќP!k (c>."2Zk!P(d qI032bw<;;SYqli[}_>'9g̽Nd:w `c!EZ&F1b`'BA`Mh E;jc>c}}ZG ,Jƴq= B" "|G }`>Q]+)r"+.Lu̜ϺksMPxic1pJ)P ()7F1bĈDRd?bZ]sr#Ɂ`ku" D"A06>?sRJuc+y1>B˾cNp ",13ЮN+@ `((P]˒ÎaHDVŴ-ݭtp@R!Bxb f)0D(JI)0X@D 1d@Ber$E. dfD&)%2!UH d2DCH(38}DfUwhqa fs ػ`x,ڬd,5^xkxg,0`s08]MU誩ihF3}FUYYYh#UA^l,0)kV{XT`Y 3ƼHTu83D#oMndP]Ž=CDu8`u&QLT{J2&]C@}q dYպ ce EDo4mX}]qq'ߏEDT RwC-ص"3bT1NH=&~aWU@N@\RSm ڊM]boQ/|7ȺdQaWb$*⭎@DekƢ#F__ֺ**$v+F#9`fF`( f}i0@D+bbfPL@0z:.\pܹ3fx%k-[r H⦫Kx(W֥KZV˰JD:wpz"k1H>@4hWBYJGtb  "^KQ ܹSk-OUwYuT!tg# Ò BX)Ut"k ĚXupJ^Ttuj]0eFK$`O**g hElq.\wߓO>yĉ7looƏuK"l)/F-һj52'+^*=j2?_noo[2omm=+fqx`Ȑ!sqkZ11f'xO>䧟~N=Tz\.7cgo]MQ}jҒb$/kwUg?;|[.XK.}(oVVMm۶8TT*&1c\+mdDV3cpP%NKzج7 Bn _ ڐeed2 mNVU/ t/# \d 1$T%QA)(@!XF`x(@*& tJ)O"OBDE="Ö0 U/dW2kժU_~OV9qƍ0w܅  :oo?3f<UʳxS~+_)dB.ZĕW^WW=X̟|O}S_;찧zJ.\xI']s5{C=ҲzjXzy8US^Zw&k5/b-eNVúQhooK-OΚ5/omm//|裏Ui. /lܸ1Vxm޼_)O~K_J4cIP%l&-/Fv~I[Mb XreKKK)ipԩ>Zjڴi.!IRŦ4 NndTPgܻ`Q?x.VZkb=H.8,cMmhh(*P"+bY-d7Y{KՀ\\|chczH&"*VAf۲;ous,$T4_03$Z;.}#"0"S`0d6UXz P1HPhRo8c=ϛ5kʕ+vG?cƌ3R\TJ͚5ޫϊ+=P=]__|̙3=;ţJW{#GTJ͘1c8yUV^K/MjiiYj^z٢2[reʬW,gLy1j^&k5/bea*疴+89昊Y}dTj7o>#ST<]<ٌyV/CbS}ʛ Kv(N*7Q嫷CMW1qύiGݖTe:1mEܻ`-ݥ'vY^: (9r,8Xk|S GD}_) Ib'Ȫ D,`G}1 π4ڤR<A)ToJ9f.Fn70~ "pGZ&K $m%zty0tPHR\aL<1&d޻|%]_lW^ٴiӆ gfow3<^xرc'O[k7n8w;SP(]xU _1Ũ]z6)iLWרd.˼jQ][ޒlV]ab$]kXӮ~Bf eQf,ϳzjbSޤ/5<~-[N4i(.iI&=CM6M0VAbULscLj @;8Y'7z蠂. gf-e fܨ}>v,m#W@ G~7%MRC+ .XfC ) C L2LAP 3|>d{Roڴizhsssl^1L&կ~d(hll?oYlق կ?y7jԨW^yeܸqtz̘1?1c䅵T,gb.M*4UQeaEdNlZ[[ǍgICyMYg/?SgqFbt]KP)v>T/FwsFg0aa>hTƍ{&L [z;$}P*o{nLs8}6NVeU/s8 /"D_v|ǧzTOwח\|%e:ok_?zy浵IE>T*5eʔ%\rܹCd2~ƍcwygKKK:>~{G65qK.\OdJ^EP9 'jAȚyW_;#:HNVU/ mۙfY*1@,G!tn$"$RZ(w+vU!+cfܾt6 jBegOSHkm۶uK3'DqҲb "z뭷d(}0 }iӦ-]s[liii0aK/T=󖖖͛7믿_R~[)d.oɒ%;Rkl匩XZWl5MVFwuXU$ӧO7]u'ۡUGƯթ%lr*#q$ϭRӧկHA:jԩrΜ9 6vBq>O]f~ '"x≻{ЭW̳bS}ʩX$1 yk774_S͍jK㯺0Rټ2TX@q1wnNe 6 ݬö,rm԰a>?.solٲy[PuvIł='|r]?|=zp0iW_}}Ĉ qdP謳*M{o}k֬y7?v~V,_&_݂1_zEٝ>Z[[7mv#_bٲw:dګ/~djYv' ,馛_ox@{WNE=gWcLłţJՀx̒Ym0‚9CJ$dYZkHB0e qAؚ#Ml )xEDtG GJa(%jx13YMJfրtӹ0l۶-+Bո48{a8nܸMW8 GuTǍiRlꡬ=ҥALn8f{+vfGӴaҏ\Uq=+QGpBf^h_~sK?[oN6lX[[[ssswU0 =KRb+ 2A*}BævV@*r/JpJF@'?ɪ* #3 6ibP2+u'A-Q&M3KkSLRbD&6a冴u}#c EOG=-/ق%"YtHj@ +Na! CK[iƌBu@4. v}I.Bg7{J)s'keuWs8vJoC?{܌ﴮZ_ N:mboN.KWXaYtil.[L\Q&%疐2L&yL]( dXG(ٯXu_kn ȒQQlbM8YGVtg 45AB>- Lj8w`<_ Va!رd jP効xԠ0KΧE"+& |vg{{ {Jgi`Cvo/p8 {mY}AB"^~ٗNlŞ}tP\sٳw)77͛oNZn̙3oag}瞻bŊ3gJ-ꪫ; &\s5{oOdy!6_UYb$Gk-9ŢXb0 OdA]biŚ|6<(Yg$3&JK@)A!mkyQu3_CDHE/ܙ.~0BND Mِ4XJ^ѶVi] nKp8Ahm,ѻ*~ 7p W_ח6o޼rG%p9s9ׯ}k68*DG19E?^:ǚd20ʼnrSa*RJR)Dv:YA"V1JV`>ۜp8O}_,ѻ*J5KyДKG!rʉaMC$ pd2Ap"POd@ QPBlV*RJCGAQDD/Xš?t[_Rl!0$UZ Q)JY AˉLlw81(-p*p",Jbc++%D>R:^(HY5cy$|v:YJV}`U"D@![feB)BfH @Zk!1DwҒRJiMLD]mZBƢ,3GQ)+à"5dQ^QXˀ:zgQZEap8~|o;8Y-p"HaWqb<`&^ph}9E3Ȍ1J~"+Ng2a(}naQ@P Z-/(` @Z BTL^Om]ѿnaŅ"!1[# Q!®#OB/Wp8c A(ꡬa`b(0ڜ(Ql#ORV8D|WȘ%:YJ@tF0mw["ҀDd,[d dȆq'HTt9ALPi_y@1Ⲯ3VUS3[BBAV2Ȱ>J5l=`bp8ލs''G2X+ֲ J  3 Cfnllrb2 IDAToe"km_k-YR)k'ɪRO!6l-1X",-J<"kL|P(ahMX*I  ں,,`"kC&ƚ Є9aDgm(-*HP!*n[VXtp81 s'kep :×H]ZE0c$`*@PPوdYJ)ĊX :2" d-CE'̜3>аlKX? C]Qf=Ej! BZcxAVxPajDl#d*[9pXKs'z#9< ;9vC$q'Mi}C`- <本~"D4> ŁB4 !վ֢ X +Ƙ04VDdFZ$aJaA f4 KciɖBD (vTl`DDAv^X,-*2zV! 3p8cyLf Np8 "%N;aEX&khȀA(h+ Zc8XE24R`B>*ˆP[>̴-bd^RKTFGH4" Z`O) :P!@ g TՉ_X2XP8 |ʂeOIy  nBk|04yql,61h&!dAytp8^hꉬ=޽A`Q؉MdǾ CA钠6̬. 2d Ð2,2DDZk f?U8W"$BPE혘lQ`Lčr-Q?XBDڮXӷkn5Uj K>bxXBlZB* SFD%30q2,3%G)bB8p(zdDVt1c1XVe4#2 c @ S VT*d+YaX7 ;[2Q2,MD L,XTō ;f6,GdLN*;^WTqa$etIyI ԑ#:(ΔJtJRFSB"rp zdD֞Y`dL#־+bC_fD$+ ]NO֞IV(̹\NW)ef镴RA38,{:* T~B\.Vc91UJW]XVAȠHĪsE1)bPNq%l/YӿUp8c`"󍍍qdPV=zñ7SyM~Fܻ`ߕ슪ݢ'vQF؎W #;k.,J* Rg%b#ձ:YGVPRwc}GObbR H0>XVuh銶]y+)â5B8E6qq])򒿖ۓ 10Y&Ifbddb"P碫2w>FCEF+m@!bRO #: 6I8%TJ@Ɇp8n'8wpz(7{ᨨ %YKق7j2 _emȘlOhS0}D"^ AA T>$OB %j VB0;>ڒSy6iC ۬L!Ȥ<42 =֡)Ф d'~KtJ31pKLPKsty.FFXZ%\V)OWrKWfFI#!$#3jY+(|VU:ڷ*(mMV (نbm8p- 乃GR̚}-; xC7׬9O>%;{K//oذ뮓.v[[ŋ{p7n߾}ժUK.}o}[֭[|x幉 Q6/"K`]D$^XJE>;#οlj70[ff kNt@t*-5KDW >֔%eU~}R1aƆaHj@ S9a_13!P ˛1F%uUO6:p ۲9R]ze0Ooۖ e/\ ;Zk_~%v~--'uJkXҩS̄8ᐎ 2pw:%00M>3SkmC)Q% 3[D`Q#MV,U]/aܸq> Jҏ:ꨅ 2E.ח[23fիEjժd?m4XrelRL/'Ja!(d@L|B6XkMD K l" 0N3,GhsH`u,qZKHfA3 ;^@Z@P0us0N`f077~ׯP`lWҌ(R"bJ*ph0XSb:Wԑn>U9o3dʤf?_3s_+p{x] |[?imy;4p՜}[F^0?LVj$"Yc72[-YK3UkaV n^^]&=l>fޤQt8wpz(=؛)U f<~u?g]pi++;_/K/tŊƘKΛ7O/e˖a(#EsK7oW_y͛7_uUq\pWnܸqƍW\qE,"^B砙MD(D + |^`iD4ƈ0 ST*2Ƥi" a'_Ɋ-"f D3L!bBJY"E[Kd9B HW7희A `񍍈"d'c j5D6޺ *ҁ*)$K {ꐱˌ(ud u\u=!ȉ Қ>3 9ïrLwGsǽ|ŴN؊n,zJ5KvMnI_߸jg{u][nUZ JE-$kzyz>{^N3NVOdա9{5xe_:qβŋ{wGtAf"\sٳw)7͛oNZn̙3oag}瞻bŊ3g򗿬xn 7tӗɓ':+x%_.t_UXk!RȠec%ҾE/o @1bٕ"Efm\7]XɍQAu&x*'{!Ũ@+ XB#ұΎ H"ff2Ƃ%,u?2֒חS@ꬰ{emym}嵹2 "6oD?QWL ?oPgvFR նdMeU6>'6r UrG;~!B؄OOoU$I7U_뎬ʭ1` mOmۉCʉ1k_//Q~Mookt :._K j'G_c{^o'[' ⚆ڑ 2fp%DO侵ZħWmgً[ӣ?=zbW(>˞\U?+p[x#ndǐ+T1*ic~ʶ5/gXZ_d<ٿ:؝s~Æ_xx|}m_د.D$qdPVu3cPnr|3o.X)uׯZ*K^p>o޼~; 7xSOxn / =\ d w};vqw744W 7bX}Sh$0 0a6?='z X!h" *v1+ Dg ePmr+²} FWq'zf)?ҾJZRCF+_P#w\xIդFL<ї} Ǽ>G>'W]Qן0Wl-OvϮ?vUr`[uؔz4̖beF:_>T?IOzw=K^yܾW=KuW{dC8ٿK[ݔyɚǎ|e]io+UU-X)cߞ޲bK_NXfػػywspϒِ ]/|ޅmYw)Uݻ`Q}Y[nmmm9眞d%cdDM8Lçi[g,/(zdֳ5hHq !KAcHB `ePD0P6 4% XO҈hxUJ{r:*4* I٬< Tc;(KVqt:/fbD&0-(k5P׀6i8kC !g }wzU<+@ CJ)ٜ/#Aah⑋Tozsza" FH̬ Z4H")wq'(Q\ wu\ݒ׎b{?ι > ~V1&+Xfʃb (`Iӕksp踌BWͰV=o'B9'+f|D '6i`빏 X5X|>>F>W_.U/aۅK~ch-\a5,`C*Q؞7t!)Φo >1Fv6O:SRd@w_YG|m}~֭C Xk۪עw婥+ @ӻj ]\{iwUEz;9#Sv[õxC:l[Զ\j$G9{菖Ϻu!-^hW{,ыk ^AL+Í5>b<,&><ϓl9=Gkd+Y}:lYJEH) T9R]#&?DnVLLZBD1.5aycLGۢ]CO@YX[( U @DRVJ! Qq\0lC!c3lCP&0i?o=9gUL+Y0t3!_OutSJ h}2"5_=x8ktzdeY'7>ڜsg SϧGG6\~{ΟXc4e<=;3"OofڧĘ ü_0wY .XkѵOG7\ugےrAOHn7`v}rd{@X>zRMO?m%VE-կH20q2~B+TUNҪ_[?Gݛ;R &+\{iwUEz;98b|$c3:gÝ57TxQO^6<6z#;8Y=p8zd˗M>%M=sݺn᠃8q9s~G2  Z1FL鴸BS0"c0}? cUwYanK=[|4IT Pkpz)@yR Ȇ Jg5z iLSlߺ!_FB0y~k-*d=THW`N/Ѽ9=j^sӏ̾v7`y%OӎvA\s7|.u=Kĺ1!uh(#eT@pj䄩t?Է+DPbc@0.*@?^OwX63I>pfݺ|dOo1#|Io.j=ӛ,N/~sQg3mdoo(F}ɫ>bĈ8wpz(G>묳{E{{i {o_x5k|~Ǐ]nt5#z˗kov'^/~v_z`#fZWN>Hd0 3D6D ^ _%+$nv6A`H#( P#B`Bkd1dbCV1)(qad% X-:>ef))|¢[7,G<'(I/?JM Іa3Bf/; p8?}=ߞެ?6!.Z‘BGNǏ\I Ϩ`zF}dq{Րyd,ѻ  ֿ#':UhSF+X!Ƿv\.g1& m>0LJ6X3 f Ffm2)CD,Eֲ\)Vq"HSC""d y#16FQ1]"=;GVJچ&(Q|#\ʲdCDTen˓s.o$D"ȋY:wNFD"s` YlbzO;pH{Np> u0pG`ؠH'(B~QDYg9U8Q+ԄQH &Bf@HD<#r ">uTzh]Jƛm@(k]Ӫ*C._bLJ*Q5 3=paB"'O 6l:0sHrTKdKe6(( tN[޷THDP bXbP,IP! " f4pU=+ AD M=%x˛#X "hBeHi!LQXy;=҃%^-UV#IFkk]uA] U5huz6vGpYbuA[9DF @,n1b*ZfA:W-aes, KY@*]uѪ#KIP *DB@ {Q@1xDq4FglY%*A9v2D"H@k!;DY')+`wq̚|7p*mv/n;b+Qν7ҊzZdLI-5YBJj*OsmCFA<׻oHV S?>|^|Q {PȊ2P=G*-SbF$r( l_>,:k@v{B""$ ^ޱ8+TU߻缲Yw5/7/ܷ="=kkmYv X A$ijZk\D"HZw/HE &ڻ{n%/~cOMgr?9@A!< (a`fk "UUj` n( ̧FA0XKaYP# ȂmHb}B!UVڦb 1w*؞j$C+K'ad 'ld&9LHy%cFs:\y)S-|_'%CMnoy=kEm v9d^[fkme,{Ikd2ƃ1p0^.ƲZt:!$~m]"4PP\QYfBp )9"H$ hB<8wNR֏xpE"oK/WWSߺopwv⍱q~v[~WWCCCpw׬Y~]zbe''gnoƿ˿L/}Kp7r-Y'NYXb3s$Jl3q>* DYgé@XB 08%H ,!"U]gS5^w?"ԀSx﫪eLw~ZOw5NjCG>S5Ff[Ֆ衕jݒr\GKހK.^}UɠN%v`o0%5ҝ98{0ɬ={fd(˪»'"[,ZT>zUy7 FGM^'묮TWPlM@ 8߶k]E;5e)"Zk1 (EM!GAe:D"H$r.l;DY[ >"s v~5/;Aȑ*+^yC׏1ɢ“۶m{FFF~~}{g>x~~&&&>򑏼]:~஻zG|~~ڱcЇ>aG(2(ŪjAŎX7(6GDQeQ֙#(Ә뽰& "b= [%;dȞ:kv@h[,J1 T)#zE+¡! dJD#gmkf};f&&?Vvw{xIV4dKfiIgT@5xA/lQ)ҊXKre2JxJ(] Cer` ExW 2c:obdi\He 9&dz#8@TƬ)iD,(,bf"#%1hW]Q %*EPUUAB@^J*mU H$D"SGxGijqeH$rƷܡI6j{?n֭O|W^ye0y>>>>99~[o{ԧ«^`pwr˫^`җ^}(f~0l&w; 6\ys{oevY9O[lv@dfF@d`9<i) ebيUى ( 3hԨd RD`#I>d#fu[^rɵ g:Vkb~r̾mwGs.FV\XR*e=+ѱ @U̽Q9XHaXёtl\/3JilBSV^R 5+G㏦[;,&t :|^;¥֤IHhF`DSGֺ\J=؉2۸wX2^;1$:e^HEuE}P/BR:A@E*8]b#H$- s($eE"c v>'-=/[OC'&&6o7o<111Xs!~qI ` ?z- #3u:Q֙&t E=sN5&vfHXBI7qL=@A1;f͖=NkCJAREI7y YҪV-XmR]:y4w}ݻO7~KM6"ƣߛ.l/!mP1IpVƨhL/e58P+)1jDT p@wb<1UiOU՗^~[_i汕SS:M;D,UOzm:d;Pv*uQ*p=\2ュ `*/;/@ޓA(" 5zZ @ARDp4 D"Hōs4={QuG[$bXsư.w֭|fV;1~z{ڵǬk/wq7sXw޽eسgʕ+ʕ+W?3!.?uj9|Tp, xxcE&"'TYStx8500g  APXx,C8sB"ByAiI-"I2]6+"F UiKdʖJViшV2DF.LtSe֮ٴvզΛ{dǞ]}{_1 npl٩Cn՗8x*Z*j1f IPx(ߙNoS۱TtgK.xͻc_FP×ikTՙZZ%ISpG|9A kg-=5{fQ<30zR43 )(Riط! <EċxD+H$D"~ÎH$qntk_ǝ{g:7e ≭O?֭[__{}-lذ'>/~~CЖ-[BL }~wnyVx㍿ۿ禛n߹s1G`TB@鄐࠶_As.hR VcFYg~0}]@<# ,# I1bбm{ar(#yKPQJ3k9ٞ,[ Yz jBI2i$ YUoTʞipZF芫X^ǟ|d=_۽_>_jYo{=^W 5yIޫ 04Uڈbκ4k@ Lf{~i;#N^~=߷cRo\u7nUz:=BnCX~ړak$ns@r‰B lI)CYPn0 $ TA%"TeB#[BH:|D48ЍK@{kE"H$90fl;DY') HX"ƯWwu믿Kjx^s5v;>_Cmݺuo|//ڵk֭NsW.ko}[?򑏄~7~#Dؽo?o|1G}q IDAT(Bx c?UU6(,, HYc +(,J43DV$#"  10CDDHP<˪8Hi] =qnPh{2iJ (f )d"PTIhz]ffIW2l6CEwzИPM4ҫk&;|#ؽ%ל7[9o޼zVQJ9*ߞ^[(cٙE-d?떽?׎ Q;m(tٯaoMԞ5WN1êRYU5(Ar I1X|s+֖eY9333{Z*eU֡4ϑL{Bj31jVG(|e(c]$D"sk;wNR{ȋTz/`_Ͻ>|D1tM1 ~a ng7 ?"NA7~f~e!78ot}HDDB8`]x3FiK@FD%  P Gr3B "qkka4˜4"1J#tQ%IfTg Yby$YMd g'y(zڗT2_j2Yy mҕk._򙟸Ϳ~/[nK|q\z|Lj]Hfo\읜߱c쑩e}/}b?!UD33]Ώ۹v?v0E鰤&i0JkvR9l+u8w n;nN71sΕeYUAE]65u|;m z[1sdNP:$mE[3#`|{D"H$rn]g!:)YHX~i95A T s B~(Y3/ !69"βFYg,kiХ }UocfbP:HtEym%V#OME9x/"٣x$VD@% 85X7p62,]Zmdek.zf촠SjΆDFvgekzˮ{u\ǯ*z?^cʴ[^54a!H44'yx(},;/ eʖHV0 \yWuzeYTLu:YL:\UTTty 0jlYԗ$IH /ƆQDdfBTJ!, }#H$teS=";D%5Ms%@Pax xB1#k (Lu\=Y } yPD @^4ڶ+Gl!\[Z{XG4& ,HfJ)+{g}dbl>_:tŇ{h7W/mO9=l/xC*kFRnu;s!Fc7^zd78oò:[ʗuU9+:眵:S!{ElBVHn6[J'ZZ]YTѱVƲ5VTUʑzBF!""H$D"y9{Q:m.yrʲ 7$Ib $ Eâ* AmTUi(Q֙ Zw"",X<0 P`!b`d15?7WDVk^QV Py@%d*!&tRX*iێw޳#R)R"Jp<`tK^&y~~nnc3ݙ. X=zxý^q/\|%_ٶ|{xrm}|gsOkt窧w>kн>=%'j$l3՞u|5[._|/\yc /Zlhci(;]s]UU"Pf/ 2 3SMj(5Jj $IBL@Zg1<6l}0D"HTruRC'ǹb N&I "Cl6  a!4 xFYg,թc#33 2@{&(uD|skvT$ 'H(+1T4hcAy@QJ*Aц2&m X[}mh!RX_;zh3{ێ}rF=3u'.M~'.Y5ώ:̯l7Ll[f[;{$F(Uw3*ի-[6])psc8eAʖk;^!ƨ$'!/kLdа'|:2D=$1(E䎝 d@lQc c*qUmyD^DZB~H$D"~uuJX$rqB[k-[BNZ i? 7ß,ֆaD$Yn{P9H<3 ^@*ڱ3{ΒeY-5-<*1i! V{oBH<{UiR}#mI4`"(MUnw:+:[lhku۹}mwGwd!ux}:ǯX󛺗ߒpO}_L}w};嬺mU_}ˮp͵+[_˴ypj<7m_e5eb2E8s^8 C A,D<(Ю-+" *D)RE¢Av,,;/L"Ny5y,)/!x 1D"ȹCxK?QD^X]U!^):s ~%Zk}hqe!Bi#* qD;VB" ,x'4j˥sYUx`.|Nɋ 2{Ap2 TB̀ʖAk̈́h FP^DYDĔΑ<--U%gJo4SݎҶ+֍ү_zĿ|m۵{fmw_qQbv>kWTkjC1w]S6effff?U\UU\eRKa$JWYЌDEJ8hq4:@f A(hPO LBpYpMiwj:#zET9+9/ك1ZŋXD"H$yQRg!:IYH\1؅2_3$'AAƾ`2,4@A߽e9Bz4P\N "apAv ^Eģ2!3^ho %\r.9@D@ޒŅae c438)VWw.׾Ƿb튴p1yGeOZ'+VL^{y˛o WUs3S{v=mvT(51wRDY'b!D@ s`J+\.Z 8yH%"$բA"c+HZ}enbE1 H`ȌD"H$ysBH\Xݍo۽uos|k@DA{:Ol.b@%J;:zivI}0@pm!"- AD =-18澉jOS }R\D<4wWق/_ ?qmܹFWrڙCx`lUz66;ܼ;zavRUUf:vUQI`蜻p v j^`ADQ }WEX_"""uZ hpHzE J)D:]/|xD"H$x ;DY')G;"sDw7=bu;m:R*=n lMd޲iՕm.9wJFQ!L*6ZpEr-`Z_@+ѩ^d5BBdf'"yd(g0 gk-E xqbݼcHD z֖id|}D"H$rp-딌H)ӓO;B16mA{~%xsi2shYfВbap΅: 8}AVUTu:C=Yiy!3H X<0x`[TgR dQk >;+7 g03{˲6eKS4]kUkr/]_}yG%[쒝v+Vhjv~쉱U]"Am*( !/og\W nFeY9tp^tafag !v!)y saPpWQjѤʢrY) !G$g/+zD"H$9GPg!:YcE"/fN`}stW,y@?U_dꃈ,\5(ʲއH68!hBXPUR*IAѴ(L2ƜQv,Z d,2`@.ؓ wEoÊE`fP Oć8vAxfd`!@n^sNCߣ]k]UUJD^**`4} vV}bԅL "7)Ϸ͉&IIF1== F$!wJfV" \8m}Jg/"ʘtdR uEP 6:X!{3 JGEHdy )$&@-0B֖xUU#+D"H Z$I 6wNRI׾_bnJ$2ذUfҦ^u[[u:T7jM7j;.Kdƍz ~l۶mݺu. ~vƍI\}=PX_; $I C!j&I$IB~Ͳ,>Cc4("ZʶzESkѮ Z2T-E曪dN񌤶']Jʒ(1\pPux( yGh̞RBMްY) 3W( "ap?SI8,APNSUKUbD"オآP Dw̃=H$D"/Ce9p@|yDsN/e{;er>rJ8W{1 ?m۶=y} Qպ뮻{Bp ;wa>('WH4I} \Շhpcg$Iuz#G,kTc R~12 IDATAM4fq.y;,ua;Ž*:l\gx.JVִj4,%e|xrzҋ'x˷<lB/oG?xddS_gwZZZ978M6}/Yog3\DD!(TbfcC h(̑Ez'd'" Qg񤵠10 ,c3,԰ | ͢%cb(Ɔ^$$@?{g&EusέeY]@0 !(I\cE_h$oDc|~y߬fOLQI⛈O^1`+(BXe 03u9?NU 8ʌ3O{V, k&i̜}[Cl {fv,♝DQ\{EiԲ|*VQT,~$ў(Z⹦7qd mIF;@)EY^90s)!s"ȗbUV⽪j)6@M~E_b_n@ ײm!O[4:D ̛׿Oח.۾[v-s[ڳg'|wލG=c U}/첵k6=a;aΜ9'|rN򕯴p<=zX|y,&aHDZdbvH*l޵Ve`GD|Qd!or( $r J.4).~s `j8t"E, bj}* %CTJ>/$N.Ya"Pt9WT[ܴ2QQADTdQ %AUPEVE$$qe2@UYRAE3,4,6('*bU|*.a䈒X8SGAUYT="fÒ貨Q%%@ f#i 2\M& 9ޥ.^ݕ1h`ŋg/ɓ'/[{p ./Eq7\cҧO9sL:{^ s~_n>|!"sr6d3q0]X(O=fZQLgl6[-y,(<]Rz6O4v{+)kœ߬ ,(KJfBU l*u 漦 (D@&ٿh9GD"r0. )p9h/"Ec&ȬU؆#s)ճZ9WT드}V|#̒IV:|]V<0X})ffP_6APE=x̦"x|^zIM_|I.ŋO4K/I&M4i̽⋍X+;{i}NFQW]uդIϟߨ}&Mꪫ%W`%Kns=3;s; .k?򑏜uYSL={;rҁ@ hM}, Dr姜hܹQ;Kk۱ckoSO=u͚5Æ 7as9{eˆ ?cW^g>S7p[[W\e˦F!DC3ZYYiaι,sNRbc3TP ` B8es>WC~guD@O ܹc$}UÆ ŋ_VZ|,O?m~wqw?{駟~-̚5+o5kq6R?Ν;ŋdk׮pY:/^/]~T:߉@+$Yu0@L3G}lY믿^u]wu5 .ȼtl#=zXhQFA;83awT5|>oB8.6444D5!ssEpV%=;"IWAV QASEQ%`Q ZPQt5S --`w UeaW"SlEUI)8eA"X=TD(2w?{i"ǞcsVnֹ{a$DTM4:@E)̦+ _e.LU*I"$s"1QX""eZd%DPMrs7 "X>AaĽQTT }`yzرcy}ӟ9sdΝ;`LMM>+7tӷ{J{b̙p)r?۷oo߾5رO>縏'+7tӊ+R4z555<̷3f4.9S.|>?}iӦM6-v@ {i⳶l폭}5?Ci8֤igf렐%Q5S JvBD "EEDT8QDDKu+ !zQ@LH$ I:HH@(y_@E\v%\"Z9eQTW@sSO{ E3&v!E5-g2خ;DLĬ^ IjEw%P\Q1{TUT!cfepH:ݥjzTa/~4Ç\t͛kkkUuܹp?sν`˖-K,) G}tvvm>`.7nܕW^YUUR;3g͛+**FyUWu5 9dm۶[n?Ν;;w|܋iGٓO~k׮ի%\2n8ׯ_[)S,]O>V|͚5^ziFm׿:u… scǎꪫ2I.Ccǎ}gϞT={v&LС^N53tz;v8裿oB$\rԩ/5/իWy-|K_"/~?Oq5kt5رcӦMЬ dX#۷o7ywy^N+ԩ-黯77x#+W~[z饗l / .] W׿>oɗźGyEYܫat?7o\*lkZnݗ姟~X,?_җb-!C$W^\k=nN:W~s==H{@ x/E?;[c+@!l5ewT9+zʵF3Q6EQdY8je*++hwQE_b(KW EzP4XrUJ9y/ 9&UXXb+"IaY^Tϱ +%ѦUAD(rED(rVGBk"!QI!"K,T} 38"Gʉ("^ER{Q1HU(RRX< +qY$+ ENHA"UWPrs@D" E"^HɊlSE E(^YYyPC͛7̽nر555j&5}7~͘1㳟,_ɵ^{gE-23g6~on۷꫷mv뭷6}D_}w 7`ԨQ/Ozڴiw}>_iӦܹ}{E}۶m}M7T\Q,{bƍ?CPM@-,g`kl}pmG9hieʐe61X6lɎ&̙ "BDl f Z-9H9*++t鲾]m/d5[ 4})jATUj$Yu!"^g A$$ZI Mf y%kq\v&(x΋UZTEV@U9[",et, *sΡ}H_!œ'SCbJ^Ac.sٳ{J$QYD;M0b}~t9p=\X|GO{G}/~gIʼngϞpYg~;vᄏaobؒ3۷˿o3fĈs &?ǩHewW_}Rn… v ZlٓO>yy癐g%_ wywuמ 2ѩzwϚ5kN~T3.Zx^(Pj;ꫯիm.rKEz̙3㎽XZ_ƍO_[[[Wj*g#2 EDAɠxX}o#Q8Eٻ\~ʷ*X 0X.!:_lȔW f+ )6Q )SBEDMKg'f֬dڮ3;KY "$ ,I?SUPT:ld(*iv*YܙV[[ߕyjkk 0mڴ͛7WVV7f̘Bv{キn]v-?0 `, ?>>}[)(k_ڐ!C6nx'?cQSLi׮Fm60`͛_~e<җ-z7o|auر%'ܭ[7ۨVKgX?T3[:1=zѴmѡC*s\dɞv[x7z_W Fs ?;[c+@;)UdsQ>)mٓ?5%_l"*JvTloDرcunQDT+bDdT( $J EEA)aJL F( ̈ HL ‡ ()լQK"i~YV!PEDVPa $} IӼxh a6$"Gz">VUU+("DŽe#r@*]NUAE/K(Y@. :E_-V4iC_3BRݹOMMA3f̘%K}0n8 9s/4WvOʯ~;v|Gq>SmZ€n5k<'n &N:]q?{VWWo߾OSSmԨQ+VD#D1vd_ Js,c2>IJ]F Lm"rCL|o̗MSJDm X& MYo. YaL"">+pa$<~fpAXzųxVݵhXvsimY_̺3nH:cBXm 'i@L?|[jsye"DdҤI&MZxĉ?@ #4'Nxs=升~8ybqܹ&M+- ?L&{KC=TrmʔǛoy[l M,ι۷|[lٶm7 #Gl֭[uuu_~yP@С?;[n+X;\TLl 5TVVZ}=眪ZDI{hXbP(n3m+ 2'beDMH HҫA`}*RsvELTEUuӧ[i{2dHMM֭[h1z#< >矿keo߾aÆ=ztyƍ]to~Gј1c~oo|-4/|+hhhZ>O<3f̘1cX]1bƏo7>|x -N<[nT* rUtڔ_.詧zg/"kԩӧ>3I&AZK.yϟUUe]tiӦmݺnyY IDAT6sl4^f$ml폭uU;U5^4&#IkdF嫽iNv`o[9׵k~ a8U-05LD$ɷeەn " Ui3i=%RW597MYLTUNO"xICf%ssͳJQ6 uv(} ~K*Uy&Iұd=7Vh"ʚ8б Ḧ JH(JMO)wܮj+lj?avz`c D4ǫ?~f|~ܸqp))\s͘1c|v>G?iӦ_^[[x_pݻw';ySLiݻ_z-#F;(t2eʔN:ު6l߂7u6tP6l;$VWW8|QjB?"8XwA?5k]GuT>}N8Iii{Yܾjg [ \.;rY:c& j n:rwL(/u`3T)GRD"G9r!)8tĊ %@޾H("r9eafr. PbEL|s@9"DBTlʊ<;3u"jhhh׮]TBD"TUc"BTf\ĪD{DTepDD "| Zx\B_b|\$aqUsQ\,*E9 V*%U&SDDVȃёCco J1!++ZN##8TH:VcJD ݽVr˱HF:뜑#G6@ ^套^ر->;[iUb͝;w/w^z̘|;ٖ-Yd/ =1w?.8.wtXIlmJnB:+eSX`bB{ۺlql[{%CW,:6* (DɁXy!jDmg$ǀ/B@QA@K!4FAH)jP!Dyry q y *3!1zEDW-WJsT*1(clW+#wVTB/̒2  BAA@ EP˄¬Ƞ>bfQfZpy B!"3XB9e g\{h,"DF"U%cJDhh*},QIY0fT**}TTRТuij6̈́/@^$- Iz;D VUUQ9+jA I/uSUvE$Ȫi㽥STq $E骈!%E2!l 0#*XJ:4OT@H@n6+!"y(~0 ewU17;z~; ]:ڃ~@ k$Uo~zGo@?MQ mWseA69fp&/Lk8% i[j`":rI>0`ȑ#1 *eUa$PNw8H׻Դ<, sjZ j_( G8^̎+$arϾ}:L 1 MPe!pJ*Ni *"΁*z5 " vV4jeD",`','" T|TY:EAUHp3PńPJDJ%DZs~XQ밤Ǐ0`@p @ pHA#>;[c+Xݴq/E"?MМivSѣGJa@ :olsƂ;c 3Xqe}Is1i>VJDaÆ7n;[Qu\Ж&CVDK#PRAO,D20WZ^D{Ϭ@LH`p@^A-UӲq )"z/Y8&u v^%^%W`P6Y=)hd]"Q2e'*(U5G )c( ,%_dy" Lou۱ݸq VYYypo@ B~vV 84#ru.֕|TqCj 'pks#w.X`_׬3o߾}ܹO=T6eُ?-[>яN<oYfɒ%oq 74moڕ-.X}L+4&_sQ.r=C?-;dFժlI+40vȑǏ_S_XV8Fw2ɤ&*}eݥ5rD@ff쓅4[X`af*ޤԈH~%x ljF \.Ǭ {cDZU@UAbYE@l*@*^E}9|⤃Uxf"Ul^8Va 2&VP`&آYcLiV׎]W?~ȑ#C0l Cl폭?6;=ܒ]b*l/my,BԩSo>}o=c핕k׮ݸqc~î%|ͽ{k{9k뮻~u֭{/뮦M´l s˦(l9IEYɴ [UȦ`Uj%8w>f̘ǯޙ[DGK {94({˾S8.wsVM .5 T?;TzlulGpŖ$ޭ$6+nLf"K~Irf݊[~چnjӽ{@=lw Yp֭۸ikm¢ůOۜM[Eϟ׿?p?ܣG 6Xg͚5jԨAw})YKmmmTUUe!ׯ8pm8pMۛg4 "ʱ*c귣s|-B `z#^z'pRa~|Ϸ7K@T.{`8RJSE"DTq1;UJq8U\!ZIأWP⒢zOU>r%1k>h2;8scf`Q1H,1DT*8UJKYYţzU٣z±% GU dDYȳW#sYXX0V^$VPjV֧1%fإ," $~{{مԇ.w]`ZS(,[ |lW餓N0aB߾}ec@ AC Xi_uބ3gܻV~]3 ؼ`WSSxW^9ye˖y.\xX^hѢ8Mor 6l/~13QS^({z D,JR (|"}&L0qľ=?珊sqeC3iMt43D'^5KRV]HQDU,4Q)BQ:$́"SAE@# &nD"#pd & a,̀^ ς(bXīzA/T!DTAJٚw/žCx+ ({Mcw# 5hC񏭍6xĉ&LӧO@ ֟}Q!K-Dr姜hܹQ;S5\sqرo_{7x㩧f͚aÆ}߰9s=wٲeÆ -;Δ)S ǿo7m? ,ަI={-zҘ\Mk]Coq)4G@l!"Q =z7SN]v}gٯObVUQAPN$. K|Α0K8AP3;AD+{Vǀ^XcTUŘ=EkHc/RK >fM8 y㢷_\ IF=Ed:WDQDDP!RIʬ lAAA5@@T݁YR"R"C׌` k; _c0a±G>kjjB@ F]C3.ęó__$뮻k\F4R񲗕SN:uj>FCoPT|^DsGfD%Ό҅s*[0l^ ZRBb3sFڵk~E˖P}d}u96I5YKr&݁((+2^{LWJHraTa)y((:t (TI+EN#"WH#)8As(WT"@B(Ȧ r60@=) )"** S"*""9%D%T[TU$dA0TIJbR6e?JNUU 䈣9rĈ{@ Ӧ\!GcO<(Ni"bsΤU崪%uɜҲ8DdQAD\Φ0 -lt[vԻ}D8p`mmm~^zW_}ulq} ԙ:nz"2yr i]'EpI7! 9H%u. ADK\3C +++#$\Bس@ɳ a9ʓBGy@$ZJ@,N RERI =$Q DB BDD* &٩(U`՜#:@k ҍ+l6:uAC~Ç0`@MMM(1h=0~zz@ QD{C-xs2jժYfmٲK.gyf.]L`OUjn4dQ˗/G6oܹsSN9־uևzhժUQ :SNiTeǎ7|s2@ pqEQ8os؂@ p@9Tr4->l@Dl:mڲq]ʜeABGvȑ#W^r5klڴ;Vm/|Dqyy_V/|v@6;2O[C`gsѾmlmh3 @usEi>ߐ+++}xνz߿>}uֱc6$*m{_xᅿoδ۷/ٱcGo=za^xxSTi6`?g LS6md{8MZIڵk|~}}7?k׮p}qGO<ٳO?N֭[7hР}c|ځ@ 8g`kmˡ"ؕOFe}w;&LnݺfOK.#GΞ=ѻW^ym{챏=؞`ĉgx>{Сg=snݺ}# &+]vYӑz뭟'jjjn?lCC}os) oٲ{ٱcLJ?a+%ݷ_fC=qN8aĈ>i߰a}W]]}ggcot?dGvmmyWSSe˖ӧݲ˲~;ST^lrwOic3gΨQzq['{p>  hѢ~xĈt \|ūV*{d=̞={ٲe{믿>pl\fʕQ\W^˗//ʅ/_^>F^\#<2S`СH sϙ`wqҥK'NHDC}MWZ5iҤL%݇b>s̽_(wer ㏛`7z} .9rʕ+;+W7_5jԞ;vl.k4FחoVWWIΝ`3gv鬳juqݺuvYf}h@ IBm!g[{9T;'{/ksVB%Dˢ\`l*[mX 8+W9sQ&]L+i֮][,ڷogy?9w|>?eʔW^ynyƍES6"=:ljXXk#۷<7nݻ7G?_{{CCY%݇󯫫{6nܸ~\H5S\ŽӫWM6ܹsݺu}7sLf6_b_9眳]flhh4r3bs^ziW_}msժU-` 9I9m![ )`EfK 6dk PV^k V2"[V@ `8 )8qrRi%6Yg`G}CTUU]tEEM>=PCmk>ĉrꪫbuub#͌9׳gϧzw6TTT\}6ee}|X,f`?<裏رԩSruzov͂v?޻w(vsٳP(t}޼yݻwr-KSlٲÇe˖esBaя?:Q(:T~@맍>;[iCz]s.rl!"-soeelJ88VU}T(8Z-Ր-h 3/X|`˖-W^y%Ylq1Ǭ[nÆ 0uW_}***Ze7Yf\QXjSO=u͛7-Z4dȐ6;A={y7E_h{{>}/^f͚[ou/7m4p޽{?n4y˛{# /6=Ɂ>䓖o| ƍ{GWX+VxG[~3;8 ( ) 7TRwޟgI&= ,߿)SZXh !&Odɒ+ .x͛'l:tY`̝2eO?gϞ޽{O>yN~_ 0 i'8py7jҤI߼ysn܏>q9s_tE-/'|2L;ѠA[n%yԴзo_cLv?|Szw5y-ٳ^ڵGSLq4iҢEx  SLy';`{cYj6ny)eѶJ` 2$Nu;cĈ}0a?{՞oƷȞϡ{xg Sl|a-U-vv,"|V:6+NܹsQ7r6mZhѵ^ιPzkM=+ƶrz٧[Uo_rҥ[lYf]wջ=yx6f6[k}|-6g箻fOKegκE1H$ A'l2'[Dyp5BԑRzʒC=gΜ9nb @YWv@VYGaGpfJL߸nl2 Sc=~2ٕM;*,\: Ym*;WAl52`泫/2:RJs B SmdudST:l)v~R\}7 3w-\lsݭsU8Y2sT8l;% :йHٛUےnJʙCշIvR] YG){lj"m; +#(Iڙt^SJN#H$p% \!{FVeM)ڞ7@+v q<7`ikV֤_cRuCv'Zɲ[ tv@VYF( agG쐂,2s}ÅuB:RJزeG9!pdy8Smd.o1R*v{\ pŋ2uMkm'GQaRr Zt (Uw[y(~JIEv@V.Y_aLJv2'ɺ7[Xenw]o적kDd׷/ًiɎ:<a̻m- Q4IsDEQ7=:=(fy[v@VY|'@tyGɺVp ߚkc | E";7Yy?uj[fKo9Sf4iGBǔ[6Lv(^Jh4DӢk; +x@+JAƘp1]PYq+؉>;v[\ R֦Z/|?nrP7 ˒0nS/ԮDݹN(N *rjQ*vB˙*#G"sM-jnW1:\ UYv1-luzO ٶ: @ZVGѯ ΙKQQcVG@T:vO[z3:eE")]V2gnc Vkֺ,dNVGD} @L4q)=cաi_yJ"HZO܉=H4b zU˙;Z}C0heH@)%֕Ev@VYGaGD{(3 vB'޻Z #QmBVdSkcmYOR:0MFeTAmJ׉)(T9ID;tNB{t+w5o,-q(c"7t;`nu:S/n;oh ctEGa)ڜu$QT:줔4{!xuM 4:,L<ώ< @:R~>ɰ{%}ooޮ{ɧ.[%s9EDw8kUo_JoB2"En_!ˑR@T.yŇcX,GpQcQtQ|{<;78/_ڻePS.Jϟ\4Lm9nF 0@P)ƶr@gT*v"t7k7 ]2s ]V3ke ;%*y)=ZHY9x [gI[7)sݏ}=}A[vvf!<"/ږ];cSؚ'*+7廿3ۋIDyfLj~E0ѧ0xo_h3fCv@V۲ZŶ$IVeqE-\KvoABdHV:H$rΠIV?7LGW|eo&?=ڶɝuV~h~m{dkZҚmaA/uΠJw (.v@VYyU*vpf!\tD<|"Z"FEfnJnvv2s{dFaO+tr&DnQ }0[M5:1lmY9e@J=B fѡ#[nDYO|f!pn)eEEŔYp+ /*g 6만8tH).vVmdՆ7 T:,fn-7j I)֔DdHVFݺuWw-Tf2"-_Ϯ0ePQk?ݽ[nh !*ζڜU*v?K)=j+RwKgӏ7ɘ"$=!dI132~WFOٳ'/A,*; W\\rv@)eQmq~Ûn YձRUUU=v.^۹6)$J__sƃŤU=ѥKr/)RPq{EtH)1Hv*o,3Dc}ʐ֚E>vDu YA@Rx<F?xVRF"eeeeՕ))_mdao;NT:lǍ-O9p}*BwG) 3wȶS9NQ4EVd Q3H"NBL(y^4#\B"m; +,ȣ갣_ J5Ӗ*Wܸ+L̬뻕U8Y4#FtVRJ{7*¶rj;ZT:(3`1ƎH)#"t>z2]n7tkښ ) YZv@VNYGaJO;%VFI$&}N-FVd)s-CKWtQ!ܙ#]?QJdfq`;"G@;)r:7 ||Ƕe p 4.OGKV;6+v8᱅p=U }CHY^u:wWY9f@J;ߞBWB lɽH]>ABxgi7VJc*,b{ecY9f@);7&`\YZk;x@.s*ﻅe[b#oڬ% T:\} _/qpx˖${ WU YVM '|KV#*ag@ hWl]SJ)\=Z%vWDRJd#TG ٔEv@V.Y?R]lpMuU7mx[*Y['ZVUUU#G0~: uv@V JÎBW43E +3 )WWU`Y6Գt+^Zx_"IwQA}~/ڶڞUBPtmqˉ<7J`)(k?nCWU YBt؛o?qk/5v=4.or'kC\l҆ IDAT}{?1ŋsIsf>n9oYd(vd=uBs}ܴ[ύ# ӷD] /n>{O\}O\<>oޥS:H|׮]GbLd_cY9fUtQ ۅnB71Y{ۉ! !+Ju]b5{[;X0N&ש{=>o3գۯo[n}f&3={K*:K$?G۶3y[X__?w6m߯ߥ_\5L&̝[[[;n؅مwsϤzɝ7y!9sy6mܿ_KN-//+L7n;0}zx;v<1~EEťSqi_ S~NEv@VYy@b/+1k2c;m؝^ueȖ'*]UU YƎ;~㍗NyY/=>oyg[o7vO={~[gܢEn}/yᅖV^1|m /4p7ܐWO?n0N:j"X;jko^^]UEDh4L UYY>htOO]]YYY~ɝ7y%X4jDGbWRJ_Ns;-:7X^mdՖw 4T:RP(\1r=;0"Meȍاq dNqN=jٲqĺQ'x<}.׮}dΜo)#gI)/:5)^8'䙇^ͭ_SL2兇7i„{qʳƏw Ϟ4i6oޭ%MZ ̝gkɝ7yMnO[`@-g;qG [Z@Smd"yú #ɧSlݺ;1bD߾}'Lp󮂸$2Erԭ2{cS6UdHV}}޽{;nh^_dŽey׬]cfY[x1k'tRk'o/˥Knٲe͚5wuWGϛa g۰n}:9v{ڜK}??n.vd>~Rp'FDfZ x[`i}1q}8вiYTmdP JUBWVn\Km.tC*,f49M袎>h-:H1 T:%|>FԨF7YUY KYm<*Ćk gnAnOKZkfR*UYpu(2&bJ)!]"R59-FU(5 *=v1 hAtYY}7B[n)Nbgo#pDd $ uH1Mtq&kCdC#. .<YE>;Ev@V.Y_aGWD_;nVt ^ YGNgj; 밲@.J ׬H$beHdȦj-zQH$b˖=YՑvwsn>KGqݫWx>h>Bcԭ"j; +,ȣ WʌP*DdUx m%Bڧ].h:ڶɓS4>_REv@V.YyU*vȜoo?KS|ݐMng kv^+t&;~ywDh;/c,rvͺ^}x/0yݻn ˖9O?}ָq Zvs~3b+?مh2p ̾gc_#HGد)]v@V۳Z~o*;WMlٲCyM2dR{2Ƚd2v.pWDVg߰w šݹƛo>ds׮UZN:do^Km8&r'4e>IG}a;YYj.ڦTfeMA B:%293V@V'*@gOO[`@SLiy͹oڼ{nL /d1cZN4a潸rYǷရ qP:kY-d&ZT:WVtÙPTsn"<j2=+5wr"Wfx<+l.aÎ6>>ӟna?X/O5p&Z't>vU1h ʌӬZUtD~7@QWԐUPY% T:܀gnnMm+]&J~"d`NjeVsA6an%ADJ)pBK[)&-*d&)1&"m; +,ȯRk D…Rjš no&;*,jOyWmdJî9gۢiڕW:msS!YMi.v@V.Y_a c\!stpCVAe@9/v@VYGagOwS]qBvz;9C}@{r6kBn; +ǬR J.<`\q%qF5C,8>wQնORﰳ^U;`kD-:$x%@۔J]s#|ȀMx B5:*,/ Ev@VkZ6(;YծЄ\M-1؂VSJqhvqސUYR*(y[n;wիw-ٳ' ]{]g:#.v@V.Y/%a57١*Z~ͩ.!df@iz't1fٲe?nڇzhd_~ӦM7n}MO馛?{w}7ݻ~W׵kO?+qly|Rcƌ>}zyy9Ac-]6ݻO4+D"pڵ_{x<>nܸk&mpGydŊ{޽/򲲲p{8쨆-si?UĽ/vrC+~5%{s;rDH1cQ)vgJ$kpU oF?nYE϶z衛nio֮]^gΜ9vE?'>7pvM:GԶm6|ϖWpF׿뮳O/e˲67nܬYlX>;w?~YJΖO[EK.K>ϯX⦛nr/X,6f]jժ{7a„W_}խyW|Wyرc_z\o7 3?\>Lj j N=ȶ(sc"?Ѳe˖-[OpRagG l״\V]i͕p5DVd52@M'ɓ']r;HGum۶~}GwW_} 'wr֫W/{o,Bk5jԨQ|ꩧf͚̳f:[mϞ=lݺyMvΘ1㗿 'o}5/ٻ[nXk_\7-c-l኷퀬\ڬT:\j<?mnvpr*vve#wgqD ؽܹ3] ez>ҥPkG?j5y;":op WI 'V}q}|و6Q퀬kt2aZmdC574UUYtᮼUVm߾=ky,kiӦ-_|K,Yd]xUWK/_޴iӬYlǖ痿VF/~pҤI|ڴi/Ҏ;.]tRpذa36l 믿SO;rLpۢv@ae5\Jm'ӡɍQH!edž&5jT"~>d!YguzŽ>p(n5553f̘={cu׮]O8~5 w'?Ƀ>zjey-6u]g϶7F#F>wǶrOt7?cm|߯8q{챕+W޽{gu_F _Woܸ1ڋP4heqUpADVe?D裏>S7xc$կ~UQQqW7^UU՗/}K-ӫW.4Om+4m֒x<~5\s5mۜO>}&0dȐs[NOi4/"U*wu%\YS斻[496l\ːUY O&ŋgqg=eɅuXY 2NJiSv)TY++8v5{]Y՞_î>سg<-( 퀬ܳ J( {FUØ_V IDAT0YHvE YIp={/&>)ƶ?*nmkH -d~VA?~<-]w߽tv@f@ OU[V\]sO !=Z>NϚ5~ԨQ7[P퀬 a \ `Eփ\PVGi|%Hn>q!@_‹퀬ܳ /pJlӚ,7i᱈D! v@V۲ J}] >3߾KduHV;vSmdy;Ѹ~Y획DGVdWk; Y_8%6ʄ-o£s#вZQvmP*3Z(%i uEMfUCdT>93c1Ev@VYGa4+7=8\e }[YU\Y_퀬ZSbla գ dWWgm; vD*5YcM߆9\j,(v@VYrJls#hƕYQmdyv͎<47zmd@~z]xB#%Y *C8R:kYwrJlsEc P U\YGڇ[.~ᅭ}tg[S]3|+ӧ۱Y>H3+v{X{ː#phP:kYg@+JZJ) n(3 tf+6.F75 *˭Qm>y <>SÆͭk׮<q„'x=n;6ҋ/.ň(LΙ;vر -mQ";oަ͛wԩv'ƍ[;~K.ylΜ\G[+GjyCឤmnI|oSR.[{G=w10;@$\P4 S}}}GBiY9f@J]x@ro=#в:3fs{ڥ?.>g7xР5k>hOm޴/0yݻn ˖9Dd]u swU_/Y2 ꪪkWXaéaAQsuD<_=}v?~s_3[h=֦fL9GߟQ5ϭ;g?3Sy}B1^$ń! p{,+Ɛ)<1 W9: !R~ZQ:H"( JIO:Ɇ/}vh7RJ)2lXC BPBH&<" #B D0̆ Ha_m!yȼFDRz$4BHC$~KRc/f8 A@>۹ LDÁJ4D$I)YTk>"mfR ̾f!cBCbD}rom ޽&I)I2~4&ˢѧOc9o~C իWYY\FC`ȏӛd%; e2H1 T:쨩Ӷ&WBdxVI˛\Uw ',x晬W[sϕR7tsu6pu;ի7nFF ML"BV11ˆ8Lڐ1lX&f;?L$!Ad94mL@D^ij-)RJiS&Fۿ&7+۾! IBHĚQYYc4TYTs,'*cTCoafa'E:Qv +y4=bKhÄS!eH%`#4<2^ÔUm&"3}m,?lig4i'W2 4Ն0I"i)'}ɼVYg}]FrTmdyTBvMe*vֿo74r}/Xp 7#g20YRD0",m/6DĶҰ OPD4EbSE9M~eƞ"R)GD&l{њ)MB ;7H)*h@(E)<怈X*EB"DYK))B֬%5`o( RO܋ƴiWN4Fh^D2(ꈤn$OfBR*§r$Wmװho#J9|p P:GYЁJ}t tMͲɯ*9S3S޳gqܵҵ^p !d|;wգǛo7hz딓O^Kn߰aСky^.!Cf?yK5}{٧㏍/Pwΐʧu`±-,6uQx~.eroNv,c{8cf_||a#{Ы owl;ڗO̊iM`'D>@Ƙhd.g'.)V2 }p̤tU܄a!U 1k%gBCLJ1̥  2ž^)z'60(sL$$ n(gOeZkÁFJ8${έLd")Fpڋ1 :<{Bc)%M$IP*!D$Bm?$0 QW )>ۋ+ʆ0 sUDLRVR)%bV‹H6$dì:+N{BxycWa?{o,u^}˽YUoX\@d JB#PLǣqLp0cDx<#Kc-HN @ 4޻_VrYH uVVVޛk=uwFz#hf5"!Y$n \$O)E%P03S@yB`5צ``Q B25nB6kDև#K Q)fB BĂ* 'W*3{4{U߃7366&R(zojFȍhy$LMUϬcWUU$Cik:vb!oV߃IJ/~ƶ_wu>}N󎫮zWķnx^]^_~to}>wo/|u}{n韾/y;>rmamΘk%s$ ;_=p̌`w?m~om} pA8 RɁ QIKϒ$al?":e闇Zfd+A)6WG`X)rj*Z!&H XP8)sUu%IRyBՔV}J jP5)@ @F@44)@ RFj B4Ʒo;3SD@`HI\F)o䄀 L kzւ)V iJL(D!22Bm-(* !!#*3:XAJdD8ڰQ1ax"A Pbb T &$v%*T[D9VkNPW ca0bwhh\FS=@ DYF( @ c"mY@1`c".c?c$?"qz!Z@Pq㙪|!"I!DR!G 53s;jCM\v2xA PrQkGU&ڬ1L?Wia0׽?yU\P!aklk!XG>p>D~p֯H[o ٳwϞ_x~~UWʼn~+N'|j}ꓟTG5 i?OYr;zMN+";W;3v7ƙqĀ| 4{ew1 ;adT433UQU6) #d:3!h^PHUdF[ ah`j;L"U 4&6<[h` 1K)ۮ`1€ + 9H؏\U!$6~ E@CFhV] eYv9GBe!hndØ?  Qe̙05Bc4O j$bYTUD0&ԚA#hQRpXYe4QUJ\1ۿ3"}^_h"j[afD֜T+4U 8agH]j:WUPjXj! @;& ~ػx!PBU,'%ޱ2BUb2CUahԝK7::!sΙGHfHE?U(psn3W!麪+v 8?9xn0lU5C#ފk/5lk]z3}|;}ٲں/> :rԜB<~b>o#t7U5pѩS,L͏3EYFqO TZf2>6kswmA̽oD"g"bΧwL6ZCڜdB Հ!XK={!3{СcsFc 4( Us oȀXc"EM*Kr\Ws. T5F2:'/($[W׊kS0V?lS *"eCSSSW_ɜs'zHU"Ϝ2UP2bbF*Qcf(23Q DHjRꞫY)") fʀDBcB8MN}_aka [@s]^(Lf!b_# !bBUs!XY{"O)|Y7MN&ԄHU -k Y_3^ܟǽ͒gpqy'g{!ʍ&*70&DD3@d3v %C3M\`\5U ##(1lX/=lfC(Ǐ?Oyum69brHqVgR-a)\K"hpzQWKLɓDÁC23TRh|ѧy6In[ZJ4佀\sPV"1yiVy5 *Ry< D&E)*}.&R5293 Re=qч~jEq28\E[çQ&7x4kjx,>Dn͖F0`Dssy2MvPp$錏9GO'hle^( DdFUv33'RtmN,O!hgtԻ"ag+df?'O|g863[ǝBG0^_u>01 U U0QpIYOi%7\οFVI _ZMz-h2"EMY $P 0wP,sh:1#2ǟoJ a0C b!xkԥγO3sKm&&F- $Ĭ,C23h4qh˾7ne"cCP=鉑NH+[8zt{fܠ$V'"mfФ=WxFtyb2EĨkҼ) 2 k>>t@m۶lr$gLDDC[)f/  džB`[y JSsPP}P VR;U02"$K|)g>|tٮF(u12I5QC`3d23PU~AUDu!4|"1 IF,ƙ0eHbl@䃊!$Y"?Y,.l~VDM$s"91~XcA|C?45Eڿa! v}˔3;ܹx#F 1"lº"KJU (}pMg\qUDw0xOYNLUVHZWk& pIDrC/C ĸWU5?*mM֑D K 9D C(R( 3sνT]*9H3E2cB :بORJb'I*Fr (P|ı^PKgbP)(gWT!b!bL,K%҆-7TU8THAV0@ H}]YKVL#s(eLԆ ^/D,xY0S0+qZSf_ME>]]}JmڽHrTYI f(jz̼|nڶu,Z?'8mhM1X=UEifQ8iʸxGW+VgP!F+Ma Ks jTDU T551UX%efQ0 .JрԪ@bɈ9H?yPe$YBUPe$HJ ޷1/& :!x"r/Bi9C 1ěCn!UepР@at|"*/)IR($-3X#vR l q%H4*OLLDȩOMٌ<9# Epe{"R }'@k- 7jAiP02[0e-("qU 3Va{8y",ʞxO \7"A ʲ$4Hās(UUU2ׂyAB*L& {vSЙ0}y珴*P1*UWY>i='9G\I vC 1o Wz\[?mo[k'b7Bi1H(M25UU!1)L͌ʅ LZY^W.ɕ`YUWgFOQU+hƬ)k/0!"bE଄` !2zp*k+mٚ@-3#St:^O<3ՙHg j]č^a-]D=LwZDpz\Q)qApP17NyF* { EU9FbT&熚!2 ! uȮf-F-GDLDѲgH!7pC#̍E-*=#9Q`%U 0*,S#Id]~0^[^m1&55jE!U0+Krlf )1*O 1\t%DHDBAVUdۘh{#1fDdnLT^A>0fjP~Uo׃LUU{E L~yԏvӹ[s&>(9I= D cR>ĦM[ ])B%k RpE^iffEoiU'x')B773i&^|ۯ.̒R/GfIwy9|ENxٟ=8?oHA5pÇg}5xlk!XGUܛTu5 V=v8}5lW7%D^oxCNB1RU Q HIBX"~@J ǚK@ԭwŅVIK7@*)@brPi#3eZHlL@άFF--vQ{DH }Fk1$F,eb;$(лD@'S,`PHdE5  5OР_f=i8sJ,DmJ1# zyj2 F(tdJ0&# H:iբ1YX9Gď b팋+430^Q13rIq M{h@5`B)$iTiǸ:`V k"O!ePNJy2t=Z^@ @3Ua}z<*0)FZr ഇw3Fι7QUU5Q/7DDd"e"`"ŒDܿ!)kDIs"JӴ@~ONN^x)@RClee !̚/"A}ο{\R{ ՔH45Dݹ}[w}c_޸]{&7l4'>|۷3{mov* Qu Sчo7LoB?E5; zm 1낷 a7o/? _3}==ٓ'7lwZ/?ٟ;s 8o|S?rm/o~{߻_c+CV$1ʻ=5i9F:w8pu [C%w] kh"&zUU#)U *1G&L͐PA*%EUCj}akLYlA33ԂQr D*hYȮ]9JJ#g63D?reH,[AS$B!7Z&8]hP Oы* c*H2Se !k_ɑ#GWo۷nĦiii<yn]~w|+{+.+>{- qF&L^+tcEei҆AU PiQK JG4*ښBEvLn,㢉$bO\3_ﲛVʮTD0;_4P @A 5fM `h#KX "ֶJAV1Ȋ.@Z!w/zxI]k2CPQc*ђ--{%307@՝zh}M[NH3Az(]9tw@H n.%ʘj! c۾yd깢TRH\}ڞ ͠񒆕b#3!2DADDn)/Kԃh f_: h *@CWX BSt!RcqE!H{ "M06z@D,%gL ,& HNb@$#1b*1Rdʉ|a FӉr%̳nϦLzJ#n_l۹k>7}OԍfxׇZV !e3kt4p") nRV р4CǞS?8{@gz[i$K8'is~!T?|6egx]u]gOH罪 N; PZtHdbRe@:[ȇb!b7G>}mӦMumz/9zo/y}gfڭ֍_%?t./~ؾ7?,M_j=K~x}7pù=wN:KKKЇ3bWuu}uqW^?N9zysK/_{+C Vsy63R˥FRs"ct>(+˧OoJ 6Whwww{ N=ёN%exV' I,b,f@ -gp50 `@ hp#~@U\)TA\f&"*T׉;ݖr:2R"8-ZړOsH]w\Zx k[wi˷SߙBHddժ*{L驂&DB #iKn!k'+elGY`QRKk\, 1a P>5Aǵokv Iꗈ5hxyb`(H_ "H,&5ک뗁٥ç=}nv[8t#Ξlybljbb,KNJȋBP1#%U2HSu$]y*cN[)*j%j"BC`"E%$ T[I@ԁQYjJBsLJT aii9i{>BQVHEhE( G +FT*e|}Aa9{*GIAC%%Eϔ)".泷ڻe6)T8ۼe|B_kuÀv;vyѷ_)JAxěιxCeY": E@EO=>H =^4 ^t&@ee!S3G333q{noqE?u4;Cӹ#5ssO?I{Ce%uįZr,N5b!ǐ;3Jsm ZG< s{Ǿ{Vw_|E]w_ēO~뮻.ξs7x O=[nyn=psW\~-[|{l|3_<05#8ϯc+C "݊TTy'J-3RWtK;/m4IW>K3I{ԩqZءgu=&p.d˓gZ'  L,L4`zV .`i| c,}D} *>:,ƅJI><6Z`f|Z A ⴋɩ]M+V3?w'g.3Բ').m񱩙奣f[XM ab߸ڕk B7]ȵ55nsfؤgR-43*HD0C@NىcݚUAx48"McB^Hȁ3<($\ޚȔ葇:-e͗?&c\-us ('OUn~tbt 'z#\nfE;=5dݥSN|( b*C0003SPE;CQelu.(u!K(9 IDATNYul93FD+ "b{4 >uUU!AfEc4US@S`!i? J{ $ %t 2˲?g;N<:`|R*٬V+-*s7븑GJEP^uŗw~}_"1(Ȼ #1}E͛PNTUտ9bb:|޴ٱ]72yVЭS0\S9SOlذwݐo.BE Uh_{>p4љDdb=_J7aC 1$ u|s.ޛov]w=pٯwv׾f%O?^"u];zNGkZN|heg^###̗c?~u50sTк2 @R&@VX>~UB "XxdO=g}3/l֖}[9o~gs^|T퇅 /?C~HX42Վc"A뇙r"i,j9#U@#jY:`EysXO"Q ſ(M>Tta0TX.D:{{<3]{O>zc rfa~by*lcs/E% 1=qmJShkk<tdBiYK xv +³iVZ/涱 c~d^q-{dL7 DD"3|`ãt,ֶgf"KȻ'9pnГ=߸QUc;'fR9G.s^k7Hޙr^t捛f.O@^'nPr5{ɢC 1C0$uD:_ Z$Iz MƢ9T}𡇎;v& q=jyj8^ן󼕭g 3L;X D$ u'F `)\|-6ndjU\}n|j.޽mG(>w:qw%@Li&ZU5 *܋@DATEDTAk: ě$!*IhFA숸U!YWeeĻ ),0YsO$Q[E Hi/f |FuGyϹ`߻X>w`vkv]y;yOpO?w'7nhzۥo;مFۊ!Ug٩D~( ADh`9?&n/>_w}qg|wK?7>OmܰqiY*eɂv:@6^DeOd9;ov߾K}vl$kx5aaq|{۟36:vGFFnd3x= " .,@b p _< /rJ(ʞyɐ:^~RriohqI.ás6nlپ{jؾcr=(!/HPǃ6WA_CDpjjM35C~)GPci4$$P }a5@"r Y9%#P Q?G1tJxڗ3nl~F^Ed|+oye;w_>tߗ{jyWww֟D ;=/>};>ǾZ-'U\R;#/+[ xw[z=ub@ErL_o\lh LDBeU0; !!43̢o.M 4o?D bj0UcrM %j.4%3KEJZw^ycǎ|M j2Ukns[\:]xg_'u{/ܛ?:rm._y{v|13 !QUq䮪рLĺ~Wgi Y=Zt#^;:6rMK)7l(z=-%V.?Л0::ZJTԑ 'O>yH;[##''J![@ %,jҚذUb #NmU!]'~,0(Q aOTF˽a9NQ]8 U4q% l&P , oTf̑ P2eO=#w}俸׿_OOn=ڢNoNQVN{5YPk>|os#/j毝<|=~-ww{(}!`x*C ιCi$pIK$_;b!x+B؝.g_f5~m[n_Xo?ロn'<8缽{+.G_{w?^s3'Nl~y?ԧ^j=^w_Ȏ8{ov|k۶m?{ꩍ_.{fwo~gꈳ:{UW=裃 a0$G",+i%cJYUYݵ͙%'~m9퉳=瞽56 \/ˡ6C|d]xB΋ jA\0" E@L4a QohP!P{6i9i+~ ;DB A+8+.PQe5lߺq Z[κ4<6iOJ~[3eڷK.8/OSNpsWGw^|*/v{ᅗm3sl_>/,_黫yKX4șwpc FCQc D RdT1 \ K6_*/||_ ꩱ\}mw \>m?n6ɳ\.+7$HQXKF8ݳkgQ35 b};Ǝ۹}ub"/y~|] T,:s$i3B% 7 GJeF=+0?D`vkbЭE]\|PwVnުurŊZ7w===eK?O忬X͛=wv#=O[om}FqM7w^z|;}C >poRι# }=SO/ё;o$I~S0V'??x5=ď?_. |YPѲ{LG$2Ԃ== 1D\\i`ɩ5Zh&:UpV-Ž)qj1:I3,-DDA$|BD!4O493Y fٜ6%MBUl j4QUjfoF\Rz|67:$4գxlһzɚk0)ULgjbphϱu++ @mN-D&v9;{mX>ҿ`\cq6yݵ7_S忭ՏUBd+$@s|nT0Mu!mF%R"o˹MT c:& 3G9eȴIbUIP@"1y4mw$ c}H G''vyb^s ?4zyr Z؄Ȫ{o{滏/]#wS==m+-#+ x]{78~KWH1s}_k2~tv΅9x5~96%SBbe*`,PuZ ֣fZohV-4^W BAFH- ֭[b_V8 ߲ޞVڸ׮۰}ؾum/{40qTIdJ_#G3j1Ѧ1u>|а x˱Xly+BlR="vUtꢋ.[|P.xpņ Wlpޏ>t=qW_o_vڵ ]oX2R|U;OVG4݈I0Sx8Wn LQC?ߗ]~I`94jdJm#Ia|ր# d.̓ӵ , J{ SޠA U!04Q=@TsƘ, 86sgk6 #LaoF[N=54P9\vYhOvJ*Ґ^z}b4}xݳt=;N|/ ґW^}jK7ܷvG~q:ڿh~fWn񮧟{!ĉO f \E@1.H9@X22 ({+,^@&+QիZ(T*a;f )@ AI#c%R D،DDa@E3`$m,"&Kkn.-яyǭ]5XUShau]Q:zݣCt$9S55d fi?~v/U\a eGB C *>U.1s^ՊP@eQs޳%g)H@HBFDS$+uK"޻y>n+^߶ W*d#K./nSS77]}՟8]Oq ~ܕs8~o2$f49z"Qc5$)"9gIt " H*V 8UmmF!gQU$]mF#cnsE]+?`VwY?uƍ+Cdg:$ɆT yu!$Y\(x#g@ٳ/=g 6|7%/2*Xb#Faı}vɣj1jz+}}Gn?օ#jl9&QE4hHy~LM/.^wy]ª˳;Ґ4E[(&>ug|u .N*lȀs&IEQk|6t"i$$ϦbwE]tk.aE]0u:Mo΂-9hXђCǵk_olEoy#?O.Zi\6U=FU(-FMrrfzC;gS7KA0P[r0|rvfo<"UUE6M" C!h)/5ҌE9ro]}/{֭Y2]?|(2qr~| _:1iznC;l7q^g6Y2zD̤Z`=83*HEgT(y»,^D@ɘ`hCo읣d4ttl%qh{{UD0A ͈ә+rRo<`K?vC^soF/SgƏǀUֻO~-{4==tѺ'=wK aF}-lX908Q3㓐^CQVW򦨢2KӠ[w TZgiPf""i*CTtJ9z۾Kxq ,=C>m$I],d٢Ewppu{yLLL,]|,+U%Tf~_>GK!͒Lĺ N fW`DwT.!"Xduw>pر\zXxA4f`^[lD9' }8=6ؑnl4R+թM IDAT@f)Agn{SW`P+T-5W ?R4˓uH B⳨T^ߵ|=+"& (?{󧧎Y^*rSd\%3mƭVzFSF@QcQ|ꢋ.}.aE >P;:2uC 0T'3A YFC_P@تNd|G Y:Q&j2ur*<{*I~22l>JJx_"E]bP0Ϭ?iU9fR <P|hY׀hliKCaKmzI7qM:sgy&@*D\=1b, Oľc%l~eb)>vt/z =cKLq7w=ýw>[;;''pEWV,^x졭见xe6NDPTۣIvvjVJxmʯȶHg9(l!:YEUP)L'UCŒuO9*O$WN"&"ő#NݱSdpd]xd>y@P_{K#M#{ͦ# V剓[y؁v?=v썬=s+? GN?~'3$ʌS-0b ۚEb߄s0QPTb\V'O@ rT@qTYrڙGό^b@oX9"7}t+/m۹2Ktn\8cڛx\wݵ\\ 4ERVH^VObh,_4 g8!-P'|QKHZ#,*+nR_hoȚn\4dY=Ɍ$LB@7?(TQ9Oɉ3_ȡ[_l &g*I+%i4޵mu7fqhX@uwv[Y7<sZ8﯀R!(^jÝB>16vbӍ^M߂%"rđ׷O|d/ƞ;[W}-9܎RIgqƅ'qT7]tE]%袋.>XA<#~EL,ރs]/OبUD6v,ʮg'C_K9И5ؒFQϡ]/G( fA{ y -%aCDu"7:p-9‡O>+ikg!fafF`68+*qaA૙{c4)!*j_(\d&.T2OGOb|b&[R:vo}g$Rv*=z(m؜$ѢH;hU[ιyhanFIEe`k<`Pm;_gi  ._ Q|eʽir;"FK@l)!LV2fk-0s:],82Uؔ-|ᜓ| -/?>pM/pUQW՞r7p'kCKW*Z!97mJiڈ2}GHHnS<4=qFH|E &pg?{WxWi`hO=kmVԊϟ$e, R}`vmYT(jRNY+V?rHH>,6?9[eA01-U5CQVD^\t41~W~[Z]tEGt .袋GSzep^ YHbcPC6}"#2(4%hM1mpB`ȆH#RÒr Hiӓ sĜAs;";V޺<KSkCNs4Z`i%CEȣv;u[Vhq>FD(XKg}maY]R rgY%?3i/E˂RC1.@eB(}j [O?QթYZضuKoou$C䲀ƘW\Ǝص}Mc###!p`ͅ ʪ4?n4(F!Y[^q^m8rha^}l;sOgj'(8,z=i#"\N1sg>F" ICŤ鳿ع.aE]tЫ3V^ew.>$OTBPa;+ 1hL38`$^ a,.̑.h@b@$IJqȚzdƠ@rcXA$v 0shQi{+v|kNƩL0UvQjtLJ;hrV,Щ`g 7Yİq !s*ȧ62 qً &zu2SPCiЩȔ"fөGc2bй7^uXO=}\4O^B ąʍq5\ʕM6M:㢸 ^d-[h{^by .k- cQf>zpP@CE߿}Ө#5Q `V^AإzԫFmjj-~*ٷJ}CR}iLNNVN /gx.β P'Nkk .XosOo{uW_aV-g~~U F=[ (*Y7lʥkO۷gɃ.DAanω[ǐ h1PitٕŅkmĉ4duwdiᒕթ]z3z>!cW0 :W-Y7̳c6;qЭ.xOA!. ݤ.$\ ;*[{^כ?.t"" mK4(@_<L1,0af""QQ3i:^ )BgYb $E2*mN#ߙ*Gw2f@&NsAwSЎdS Vu0V** sw#"TemFfrνY5 4HCRfP  4Rub)!/h؀!A~> YJMiVwQ#Bʄ[fg","fȓD᜻4@p6 DD mLOmyc#Kn~^u2P+fm a߼Q&Yր=X]N yKDTiԳrO4o+>t-XoLRxB`8Y sHF*4bi:'lCKˏhD04e(3Iimj}dҋ(lX[C!`\Fj 4M1RZ*֒Ŷ5UWX0t͕ q4XpqlY#C Wjk3U0Y2ΆIa:ka< UTR`!W4xV LIl%3(Qt&߀Hs@ h0D0P*D{kgaOɭX:/Z][Ξ{ߍ{\Sly ׷l9]k7Qώ⹧=J%ak??4V;nޡUD<γ1ˆT dbIn P,&"`Ytϧ>/=$][>?ȜsN,oH,ɑ%+S_u-Kߠ$WQS];tꢋ.~et .袋2rd5xk f$c *j!z͐2YA xUPcE# dYUUWAYUGDCFUDL *DL}RYրُ]d]qA3k9 "iV,45Sa[UZU!P/ܮWD'fFSZKN: P"BKT8Ӌ"U !@4 l@1>u0 76DI# :d`Ƞg9=Rb*,cr("2,JȌ1jPTr}[sQU`s0 @Gm3\6h-@IN.1{kY}b$P/HFV xJBJH*S "AnB@y 0)7[Hh^A=(d$ bњB`E"E 3Wz{Q%Cf;s :biB Q >D(g#a$qe N\Q;c}p:c@ (O&_y+DqHED'"cL2Y@(#(3Yӊ^x{ `-QaF`!рDBr0 /<.s@PCs97CuVt@7j@A˂罷*@\.;I3տb@1Vt՚{8&c=Ky Wܳ[" 3' !(G/"b\$2\{I! P*tf[hx_O]l`g_%*,˭rq&طh-x\{ExzZyE]t]®.>?կv.r '۷߰F׿xGַNLL,o1]'@D<Ζ:itvp.\RstK@(GGkWjLwv,a;Ўf S ڊ D" afV]fZC6y{4BoC#OڨD0 ,"R /:d*hNaP4/$2 6;#j3/*؊lE@a3ޞ֜^jmfn8fkqxxxqE0}Rw 9k3~yU ԓIRyddDEB>2:v_P IDATf9.D4 4VUYCD2Hsl:xOZDdffVBG{77THHXyB-kfiڛv oƜ|e株@cdLT*hiȺ8 =Zk|9{^3dck"D@eBB9'Kh^̋PbaTrGMWUBy袂H\02I*kܦ_߅*uuE-]]Sv^{Mmyk7n$I}-[O~On;wWy1U]0<^z%С7>ءÇ-];>^~V=xk׬[nΉmW|cW?3s>6.u@9fak#U' N &$j6Z5ͮW] n`هD1(e;08[)Y ŜK 4k&ّlyξQ.y<˗3ǃBk. &ُrόq OWIPpv@+8CYIc{G"Q osbHmQDUjg[/|AU "gZ"Ӣ[*ZUP &j~0"JSwl <Ϲ(p~2zBEeXkLr]Ud4)1&vCzTAE9&"kNHYD-z-CD"GbB <ܿei(r!J̏ @H6`˰tE]|P%º5k~$I BĽ}oޞ/ cяnݯķbׯ[~u˖yfkۿwp>QWJMWxsH9Ѳ]@UEY4'-[ ֝95擤eHj1Н;_s<"Đ"roa5Vs+VUCޣAI4Z=<3Jd "*U%d̽ 9'&Bm`!}e DSAY6|GGbNDk0}@D:;VT0"McmT(B5BsPЬ[K3 ۣtV=dK؝;#7ӐSݧM.P[]b*ճj,jfm+:uElv R*IKEؚI˕[4hk , ATED]oɒE}g6 k $Ili#s /Id㨧[1ƤjӭU:.s"g}6٘q9M^Kc@o<4P?+JΪ 4|W6Miku.Dxf@U:jɩrкɋ">QBkBofYZ(D!("ZKjEu68RP3,$"HNӜV,5s2Bh_o|+SFrJZc TOfi="CZ+5bRۯ6wj2a"y;lRy˸=J@\쫧RS(#y>{1 ]HaGϙy5tN($BLU5dfU.Yj\ ,?{oGUOU=rs3$dd f0vWGҵj8-8HvB2@!! $wz}Ǯ^D"^[99UO{=p_T,ERE͢ ש50.aj$j:00P;&+H ;9ъbhbbSzkF4q NnZјvˑJ8FH0#GPV]Ȥ"}u]qG Dq2FR(ҹzZ ‚IE4g\60Axtm$}K&2 HLNߒ!03C!" &c|J-Ԏ_Ѷ?;uuŬ-y> ھ+W~{s٬u `w;z@ƍ]pѨ41`xcuuZf0Wb @1#tFJEđҰ}HR&[L&k2ƯDxSn50҈$2`$aҀD@I+3)-pE) rկz \O^izx%nb)^pWc`Ϊc*71&cu2- 󅬈_V 0&WTܸ=JRXF-/ܞi5RW""H|v1h@<%"ʁ̙l6}' 񝢟A _Fh>8uD٢Xc0k E:ۏgwjBqC=JRP]7`,%I`GyX^#Q{{[Xºo !mss8,J$ qF8hUU"8qbX4SCGݩSu]*E<;Rg2MC"곎<(b#\&"cBѴ`02 @5}6Z oB PY dP\k՝^`N]y&yF(,0s^[ T[F"1Xfhr@lMl 2 PCD,E. SwWBTP̖4nyUq# JJU3 }4Vf kqXI߰L Gܢ\10W|֎"dWs4{a#Rbk-"Vu3ޘGYwol8@py\'nnY@Ǿe̿F+];uZjǎ_]jZjjM]a DDOPAXv<9I"#KDb"CCF1nz9Q4hK 8G %v4/bU2*%!B@DW NWbcT'a] d 1YpBѴ-" ǽ>#1z.lĊh|$Hya=p1r(mqeM%Zu a G$W]!"F)Mg9nX{ F  F$'&LQLC032n@'GBql̄ĄCc EF1yK!64J)`c"BRj "(#` U f7Zץ$1GJ~d׍ٲ0ޥc(#2>psZ{X?(2mpY;-1iojZj7,vZj/3TFChIJRdA0- PHyD`ޅ`A@kc>DH H"A>h XE)!f hZ'T(ū;Gi&I"Սq ̌ 8` ) G'F@q*uaIЈ&$qCh@Hp@D%0dB`6RU 10H d! Cu 'Sb/f:!D T~ aX!G]mE=bA"Ra!K$> F($Q'~2, ahBN$``"H1 P: 74ܐef܈J "X@$ Zr6,yMCcq56cԋcWIYa2o" ;7q5 ˆrO1Jy~$mr Ddk(Ƽ>:\ Gqތvh]xZjڱb);2|8_i];ݻgA74kRh`P@.=} 4ʖDbG6@gND@!iFq@P)a_r@@9G~XBD ڈ-#\31&j|K=H] 6rb&W2GTHv+9ٸ"hdYE$$c."T 0b n\K-I! ) "ɆyMDIJJX CD?HTcԥ7nOA6jПf͚;wWXHU$Fu]b^A2"zǾo۶E]`+&AnW^yԩS_f (HRs=k֬G>/ϧzꦛnԧ>DQ +J.T* ٬qi;00P(~SSS^WR L橧v;__gϞfv²c~ݻӟ~/馛^z}{/?}s:XzbVرo?쳇i fYcL\v]WH"H*v? ̘i=u Pkhjjҳ1 .məLqAq^cNl͛_mٲg>'V*wv}7XX;uúRK-#k)K-R{* Py%X E21HQI?;FDF-PQ ?!ّQ0"*?B "`"?""A+&!+1;^i% Hf(h|D0.81| " BEa,9Ey'ճQi^4\afo8i*EH""i֤YDưpTMxXX5boX+3,Q> ZW#bEHCᤆ?CPJ۸? Db4^"akPyXs,hcA*6$$x"fhS`4m&<;ܺue˺UIbά$ jLoOQ""km\MMMDq2%x*jmmU3+SpTa\pAx}}}DԯR(1,QΥlZ*[j*<:~^@ "}'~ϛ7oɒ%W]u /CAljjT*z}ٲe<}?쳟7 )rRrDD*Vio)- 044T*D$!bVj/d2/޽{ŢSPU{{{'MTV:t}]r%gunٲW_5,^+Wg#/"+^|ŧ~z``@1VB!Ur*{D?.+U D7>cKDZKfVpNY;jZOjz"lٲo󼡡"L-RKc)?'ާOi]uu%WǙ}yy/+~/|o#?/ZM7oڲhSu#M0ᒋ.4q;iyjQ dbX+"(t+!wR"!D@]>=FDc CGd%zÁ]OJbX4˚X0w3#/ؠaWtŽYBv)lf  QI1]35&> d8'J$ QT,OFe'g1I$JzkFǘ `;F c(#D]أ6 Iu0pԷH {Db]!G%O2PH,@@j }%0Rb2$Ԕ AO;$@"*B6]A7Iw1}DTZb+u8aÆz~_z饕J%ϫ "OU+|^R^WrAr\6mnnTȢ*vx}?*7n\Zjw4B|nK5v"=ETvdU唶5؁J$uD D!%l1 P͌RةBu]SQv(')xƖ󠈀XaDC !X"un wkNW1[8 ;:"-!YaPbU7DDQx+ CQ8\ Ơ6q01!#TN"숋{`L`'RĠE$ BE'4X1*d&J1̢s")dHGbޯq 12s*+ EdH<%1$Ӡi5^k̵R/Z UQUA`uݦ&X2& $,P((P/I$zwܸq˩Mq{7Vw U6^ݢu*.JZYkU S/}ZjvY ƶx\^uuުG5K;U5җ{ӦNWf3K3ϼo6yҤõ{̞9s=S:;{n,^uܥv1P@$p5\2E)Z1!0@! hD* @Dr(mC X !"#DDvgBGQ2=+:!jbt}(*JJ=Y K|# w? $ !^~G, `a6jJ% S?3D`Q%q<@r(7RL*8n?H馣D0N8{/cǎG}_:;;{>;w3gΤI|AaTgݷoߺun:mڴ:k۷o_fMRN9uTv688ӟǹ&O۷ru!^x[k??A\r%~\.GfΝ'NܻwzNmpp0 y睏Yfmڴi͚5Lf֬Y=wy_~[o4i93o޼Z_RbX\|y>{}3fL:uΝ]vI'gϞ~Riz%ٳgΝ~wf}wXX;uúRK-#k`6 o 'TZ_͚9sL<{c U7m6~?Rs=wy5\sim۶[n[bEP7_fͺ{?c_~?.sy'4h?󚛛r\X6mڜ9s:;;?5kN!lHŒ IH"ؑ`.l0 E{)!$T *cb)k1Q =CzAVK B!Soeh} "Fa }ɒ%3gT25o޼ٳgϟ?ժUW;͛˗/g>pO|gqΞ=3hmmݼyOpεk>CHcj?UW]dɒ38Ɔ ?|ϟ?o޼ V\iӦ^{m'|I:{7 ,Ƙ.讻zD=k֬3f N۶m/}lɒ%;v쟟s IDAT0Ƽ˚RtwwuY[lϞtI ,X`OY./U}KuYzSN9eѢEttttwwoٲEީg"Hͭ~l.,"d9s,[,oٲeÆ ?y~n۶n7o^{{qrʫj̙ 8p뭷^qQ'tҷu}򓟜7oޟSO=X,۷뿞x≓O>yܹgnnn?`D\j՚5k~͝;o:O<={L> .8͛~?O7tŋ{zz̙z믿g/~/}nnnV?OURK- vvT-]rEP6m|ߟTz*}3+_Kww/x~ V,5%BcHv#Aȵ@S,R9br=dK"!3 ĺ'@0JDАCD, T `԰ X~NAMlA XA Je & bCݒ7 μEԠXb C @"h%F* 3'I  1nXDԛX AŢ ,D.3}QAMêY' *W01^4Z[6vBr#OXDqnȡۦafƠyV,"!A^V+ sl-2#[`&6b?Qg%@d!(B\Q/ R G\a7=󱂺h5uM< B6mjj>}ܹs?{r- O=\.^}SLq]wܸqSLQ%׸qTW(&O͎7nƌ3g\paXܵk>jGGW_OO[nUѱh"` :th˖-===gyttt|_mkkĬ0sB qPjo(Cnz#=Ю]zR|>77sկ~k׮m۶WՁ z{{׬YS>lDk~9RK-.Ԏ-?yLSNY#5K9'l7p{[Kwʔ)7lcfwNBB$ 0YMGVFl jT[u3I#9$0@ PfAgf!Aؑ @6`B^IqA@WCHdDDTTP'$HD,"1qX89&LBmDeF"v,-IļkGxd2⠇0JFHjF!Ba@2b1f"1M PHhQ!(C @0NP +!" "1 1[$ ľQQ`y C HxQ=4F4j"ZcMx1M ϧ[8, M;Aā:9D0DV&:4:yTJh4Ghi$Bm1B5INDXtU7X,T_Y+ؿ{{{RjuϮViIDZMU#D̬i {A &{ѱpk>䓹\_ה,5u/uc,˹\:·~3Ta(T/-ܳgy' .rDR`|ivuz3}׮]0~xո4K  k?[kǏݫ R٬޽{ǍԸm iTu΍35C[XUeZЩ!5^OOOXlmm-^{+NKCѾ}tPL""---sΝ;w/NQ:.$"* luŊ8w\I8fmnn>tЫy޴iӴ/kW^Qe0RK-5H[gZ}7w?x"}Ӧ%>3LfJgge̙?~SO=u'?7_wn8qW_=~ΜWmԩ]{%cnڼkʔ7ߤԎM3ƨL b<+r3dC FD4%q]A9@C4Nuk% 9N9P%`6"`IB"|31! Db\FT@V \J kl9mIOQbwZ!8(P3F$계 0A"CIEΐ $[b4Y l愩r!vQV"aƳ 8Ȉ{B; A=7PD$@(k3kkR 8rB(bITh$s' B.Ebk'pF;̨ EBءPa`͢0Uh&VDsQ`0Ay 00v ¸VQ N#"E`GQθړL&kZzf;::}XN8$|^Sh}(SyBqĉgy&eYe47nr׷=#CCCqY S_K-6) }[*ZZZR)y뺭uvvqJEqZ-O2xEzF jbS.qMkd;::hԩK,)JMMM"RVUSJv%1MM=NyO֕ZjAK]jE[t֬mAp_rIrk??~K˖.w~q㮺 >:Kv{fL~>41]]ک]]#k ;c̔.-\jǤAC'bƭSNd8 DĪ.dqh8i&0kcrGWP e_"^n&f3MCrV@!c$ʱ p ⬈@$ &nH">G7 ]Fțz 6`;n&-x'A{l% C($$"H,$F':1VfP =eD KŠTQ"CDA`B]|عP<%U~a cKhc[ CZ0L3"@qC4@QCG<3vEp q"dIH|`@(rFIFBxh}d4 Wj꤬aQPo$2DB2 ""X qg!"R`)2 ("T;4*U0ݥ8Ŏ 28GygQ7T*qJR&~G֯_g8p`]]]PAx&L:?>kN8EٍZd2:J6s]rkl{LUE T*MMM'tիx~J֭[wǟ~Vڰa:)V*/RK-.Ԏyw_: r)D݈|cۧvu}ӟ>1cqXޛU]s59tt 5H 4 -ƮiyqzIMݛ+W*߇$rT11`ó1%BQstݬn>b,0_*k5\s͵1ʕFלT&#ĪVPڕKDDe X8 h7\@lpƘqu8:ϳ"WFFGef[bZ= ySI`! m( JKYBee.יIҋDB{BI tHQsi[x\:l mK`TV2^w]Dt};v(;vLLL۷逸={j]v=z4M{.k6v(0 7l| _ 77QR^zڵk׮]{Q7??}Ac߿? û/pqqHk=0 ;K/t߾}ׯW~hRce]vu]7pÅ^xС˗xk믿~ժUF믿[~Ǐ=q߯*oR[֭[8<7AD}CرcÆ {yg]G?ё#GyGyd˖-jSlOٳG3mٲ{o>eW_}u]w;SQvׯԧ>OOwwW̛C=ǎ{GΝ;gffvڵUV9>?ӗ]vٕW^ooZ7nlAwy;vbb{W\wnc 6mE]~Wƍ ȡDL׫AfS+2ΙPO^@h4UCWSy2^TÇbD(D"B!dFFt6A#ELV!1#" k- 6L˥HΝ^S{qﵾ/"Q̌LT'Xc{5FB1zĆ Py =25"x&$($tCBN;0LȀz:Oz<22j ekN84_Ƽg=Ow%Io߾ᩩzj6m4:::22f-aÆv=77lٲ__|ΝAlٲeڵFcvvZaÆ5kDQ4??o=R~j 6oEsn֭]tի0̲lڴ} VeYv+ž={/_vک)=6~z˖-W_}u^OD/\86oތz9W]uUQO=Ruy?jժkNLLi0>>qƉVnݺ+Wnذaʕ[lt:333011lٲk׮^VZ555599Ɔ ֯_?55aÆz~v}UW]{Ƙ87nܘeY$333V۾}{fSÞ8q錌_~|||ՓCCCpdd$Z699V5k֜s9FC|[nŊƘ9m|jjjʕ:u5x߾} SSS֭Mtbbbʕsι;55%"'NXXXٶm۪U b[*Vj.l֭'N%iήYfjjj˖-4sIDQnݺ;{jUW]z]v%IiӦUV1͛|OOnݺf͚۷s}/Â^?sJĉM6 #IRڼyc sDF,pҧ-5k-e'3kF BU.rN<g [EQ,--iXVs KKf99ٌ9x`va>{?Z=r9Rk0 u眓L(YsB(= X8 ZABDq(/D`H]!w"HUw9CP8#yB(/AE;)v2H5De62$xA*գ<O4f/KA塕9N4f($I4v:Mj6l@n‚ U:nm>(W-(EĢ(P`7<<P+?h(:NѰ.,,跢&t7GʉV%bA&v=99KKK˗/XȩFkȧiy@Zj-..ifzZ=V&CfIDǏo̼n:t:thaalNMM%IT;33$գ ㌈Zĉq+}*sUK/FQ5F4nW'C FJNרC'JzNV`fj:qkTN,yxxXǼ:Jj&[ZZk&;tP$ccc###,˦,5Yx'똼ڻw'zS~.t=yn{9xc=WWVMrm?}U"lҷ77?y}ƿO৏h_,)5!%-83ygte8c` ((⚁ 0kACORy mQ`c\OM{"¸fͨl!Ez|<,cHްADasejb`@=x,E0 zEwy٨GyM彏#HȆI\EȌLBDAW`Acb0!,#h-F O}#0 ГIp`td !N@X0 :A H|IkC?}<.5+GH $l|`MIjF$!br>a P~#)Sj=ZɩUb|z(Tƫ"xYDJ$K"|.=Xug(XǞeW N;:sphUni1t7A K[ 7vNOdmf{d!YtоݴjoZ7 G:i4?;K,o=upy[1K_"?A9#eq<]JݧL倱g.k #譟2#$G,b94;o ᢰ:{uEDzwXA _ED9dO]>蜇&BEb//A"!mqAzAD/@@ "]Nd]6y%CfZ3p()0eP;$@b^ _ gKϡp/7.H-QQ꼊xiZy*Qy*ޡ/o̓(ȃ6/DD=Euz{5G};񎷿횑rA צ ] TV_k@tzKq'izj> =@ ̬7Hl7zҫסGͭ.bJVnSŞ$8O/`7=Q՚nuS*Gzg>j ?xI@ 4@?h_,UN9QUR=3 rg)sݗ'"" 1Z1tH9 \(06ٝ?r?ͳO{ӿuc?z>z"zr;-߰!A{?ܷw7u7$>~d SfdӤlU4%* {"֦q @qdԳa/$1t6V ory =E, hq /SMD(nSl< W>@PmՂ%Ac<i1>@@Q)ƽ4V9e zZܑTxv'n{y?nϟs9֭;'d*O:ΈUgrjvW9z[5" [0@ 4/\ 4O2N6 a1rI@H: T`cA,^/5ݕaafcZk 1ZAD#fc ԧ+y_ah5ԩn1hc9H="̋,͒;p`)C z + zZ<|- qe'H A:/=le]V WʼnVehEAxkuMs"O;:NMv\؏LS^G~?)iԚ+εWi]?ծC2ۢ$(k Ec[dn~]}b=誹c-yh!ֆa|;r}u:8j}F-cKTK/42-[3tΟE8ETvV#"W>3jn*#=˨*Iuhh ?\!-4Kψ2W]ZcIt %V`0/b dt$Ȍl,9 `zS̆ɉ¸^cD"/ ZVeZFq8B@&D,Kp dL1 0 P=:Z!AmLA;$v @J P$ %h9B [ r.۷vkDGʷ]=54~nx`K8?:w{dǣ+\5ljs%ζ?Z1j;̆Ƅ9 ?y̆7lfc?>p-Vge<:6Q8n3]F6Ve÷Iu ffz~vEpٛ'e浒7x/).r!gaBkE$^]$~ 8D jrc"^;DDRCe7!DtPAԎAIiRH^Fn:/"Ȁw@NrB8 ̌E< EQ G @GDރaпؗRPVl|[BR p{z!_( Tֲ":_}z?~@Y嗄+i)&_ӟǤ܊D-\{V;@ 4@/nNH"b@sщB D zDxJH,3Cyc CfOtETxk1 cL i,%d}Y\EQ1t B!} \kL6AiV|'IY//wɢa!@\6'&6L@"K|G"zB!ZU#y 4z"23܆&$_L^Gk=CyZE7e\B 71Ak\,͎m8^nw!ɗO#A=a.B fY='p#"z'gyYml68v:4 PN%R=2 pT0@KTA} u.!xftP( /2yDDґE]AF_kУwģR0x@A`$Dg =bt2`GH@l\L Li8!k$d'7Pw{ Hx(U ^L1"A5AT=YڌUt|/Ugϙ<т~4ź/ 4@v5v 2?Y_^]5 /<2/~>>|.mۆ^Uќsq_DU2;vt2$$>jy1Ė 06VMvqsEQ23lыgѨ!i0G45ZXPD" 9{< L@c{-YZk˨X*-lУaȀdh<,zU==apbPE:AĘ pA #2ؚ#ELA1"]Ji"&d,尐4gg%&!BdyYV`Aqm|g 0hŲК"m)%bXZr8]`#% zuBԈ@Nq5\!ѶF/Ѩ X4hF:fj6rႳ!1b )btUG[(LCDFޱ#F(Uy'MY8jz21GB"MKIkp>/SYTNܻl _S=EZ낿 (`b*z! 8${"4BsFY?{d4haHs |5eYc*SeYS_ ռuZWOf륭<%0VY!<_Yl/SkOG{?Dw,<]?߼}~:6:w}wŏ| Iz~ (XNA:}ϏV'2,T0˕{edϑ1l x(=3jq sDFP-"GOۈ\". hl9_ ` 8uԟIPW@=PYlocu,wΡ="lf&^a/w[Jg3#[Ν|ۏwo74̆UΒEr6lo?糭v±G6iEE5ʜxdm1vA 6΢lK8tz$!gX=R.N$[k9\W4'kX b;ԉTR ZH<!.pِ@ķNB'# YA4Jʓ"BKR!""ι;@y2"90,A s5Е!"{*l|ۼ{u㺵k?}+V4Av,Yv+Xˀ5CMCkǑ/P;h-, qjgƹ0YtPIpi4MRMagtrj|2QEJtcCCCEQx(vJ)Rl{_tVdYhL]cQmD8 ?i`lǏ3q\ALeg: im]ZZk,"Yy^׵m^v]I(qwEQ$I0 uO=@=W$iq1faasss:-$y衇o>яv[J(ԯqgD 4@ 4 k;@:C?cǎo9{mݨIx*kH!~AD PV0KW1afcKJtm1F8'.+yAƨFIc #(%I HK HM-=@P l XA)ђG06\f:SIR'CM<ؤC{XXڠ;{b恇Ӳ8P`+pCsClt.v}_b䊹(" -8y$>O32l;=9x6X7"ő0yh; 2\w/Ƒcgl}q(o]郚 H:mc^ WQe!A/8&0 C}Z5F's|C%V6:@w&f ]`JT_~!:2OS`b8i=xr6uVGjR쉙k77~w~GVX(MIPөd7BWGLkQ-..* im333q+fR^^!@&~;z EQ&!B"$AgE// a&yiZ`> 5 jy.,PUS }QrU8@Y`m8 $1Xfz,50 tK쁢q'ŢIj bkmFdD#d p (vZs l N!KLR̴IJOۮ455AnWS}K_ڹs{8tЦM>O?~nڿ%\i6|;<t:/o}?I}{oy[>##G'>e˖|+G ȑ#۶m ߿رcjժVڵk]we9qĪU~W~9w7>_|ԽޫCh+o~nȑ#W]uZhLzyAЬzsNx%\{o|Iu׾&"W^y?(no~sss_җ|K.dzzzǎf}y~??֯_yn>x]wjDdddcXek6s~(?Ǐ;wڵ}mvy晛niqqqrr[f͑#Gz+V=sLLL9r$=7;vp [nݶm@-?vu9|\z5A`@ 4@6 @O}yͷv|ӛ^طl՛o|ӛX7m7z]w~m[n!6JutgYr{}̉z.7Zxa9/A3\{X)DFCZ #^hTA\B:%$*,QD.MSt4II:IV<ɲ8jFdvvUe9W4sIHI TBSFq-5>kkQcTYz/MUa4RF A$4Bsrݭf~?޽i@( kn͹Ξ~!J9^EpPJk9{SEa VI KA!D\XaB6iƱ"CI6v&a#O U`mshE:4@ űTnuCm:)-H^#),B!c-H *R*@ttN۱tj8a+%06Tlll RLt4E4RJe"r( XGrN8*"B˚Jc m2](<9}"AD)RDq6*ZGeľQB!k-P qT?k%Of8 DD)B W2UK;LYBcDt.H :l8z&ճ9qLrd2ݾwww/_|̙,O۶mG?ы/{Wy T*'_򗇇o~ \.?Sa[l7k׮ 6,[, |;SNЇ>N{.K};cΝg,Xy|;ϿVZc}ꪫկn۶n[n oo_zX>׾m۶-_zt:Դ}~Q߿[o%~}}}__zkfΝǏ_nݞ={^yUV:hGGG>7|8pnSK뺽|Сrgԩccc\ゅutt~6lZ?z߾|򎎎;w^xK,پ}?>00p0 ,XxNcǎڵs_R__qpqԿP 4@ 4n@{sx#_U֟F]gwVhpFgy sW<8J}־m[Ow77w|||)󌷧?S437Zo|irNW{M:W{YJ S)ЁJfΨde.j*K)%%D)tPZRRaQ8j\.A`!G3  W*iӦXk֬q]X,׮]\~瞛fk׮]bűcǖ.]zwݻرcEQGGe]rJ!{qjs;sūWnnn^r>e˖K/tL]veLZ裏n۶/_hŋYnrҥ .ܱcG\vΛ1cƁ̙sWZx'o/\0o}rL#Zk/^|5|k_(Nwvv\v鷶wyg>|0 O?}СG}t`` ̙3/ߺuO<sΙ:ujk׮wg||T*uvv^tE===~&uǍr)|HJ)ZRԲ}e}5I]f53,Jr bX*`M6FŚrDuTjJs+@ ҵJ@)%DƐDGFء,b"%Vu q9A剱C]xa6);uF[zێH#B9f@$) (, džNl}R  Ec8DW)AA¨Sϔijkzft]Tʡ_Ϟ(0 Mcd(##ظ5xI̞:sںxatB)brPv'lu!ERg냪3haSpV.nFRbH$YU:rAcFkUJDYܪR 8QTΰXdmU nj45 !^(DD$+(9|JdT㟲v<@pAQ%y|u<2籁@.2eJdzgώ\.K)l2::3 9þ.yUd23fd2]gmmm-Jb^ڿƍNYx={Q.r---SLΚ5mppu7 !o~'N "'/\|ܹs]dJ)vٲeKPxGz\.gT*)Stuua׮]ӟt˖-]whE+VHRb;[+p/cǎL&s}r}lX\nڴiکSB98^mmm$qlyK#ϟ[=_<88,^{{; gϾK:tH޾bŊM6];vXtiww7;f2΂W9NˏSݵy$ IDATqN\A~w ݧA@ E4xb6qkO]-Z@""  C(9 @!E0-g D|]I,B h DDEmтTQ$@J)ђiD%VDdS:#b@)I9M5ƦŢ#ǕqRka-(fs52ML^'QZ|Gk E H\C Zsz1@i-[(P ZYk,س4t_LU/\bf잻$ H|d{:SuJNNG4go eO?ޚwK>#8RCVGFEmLO +}׳%J)`# AhȠ"ZF"֤D`@h @ 9$>477/ZmIt:裏?>~?X,l̙Zkol6˩8o&l bV:sz .,X#įSĉDߏV2e ;r++̖+gcpllKO\F6v8~x:={v*T*7|aT*B3f]GyyNʝ`?c]]]K,W}{^tESBE!ӗY瞻뮻⊾>XzVBUVNai湘ֲcl6 y+|‚%FLJ ttt0iȃϷT*5773wWo޼ZryRFGuٓ<\rƍΝJ,X=sXf< rD]bF6} t 4@ B؝?Pj^>.9Ba5*L v;8JzΥ>$kFpNY>$_NkD:NtQ,t"B"Bʑj.^[cc"@@0FR 1RZ[+IչU)&+( IIOGCkpTq=) Өd*q!W 'LiZghPSrJɡrS:+cu{HHDiCdM!ܺ|yܞ}/}lSe˳/1'(%%x wL~vgE] iz(BD"J˗/Bs=˗/WJ姟~zڴi===tô>WqR'N09I.\k:ujX|gϞtR9XKֲa+<#~9DQ488X(Rkfk׮=t޽{2@87577_x>}wǏoݺuժU,jVKrڵ{ŋ_qA ѣGiӦ]uUpc-Z4gΜ'|{{[n-{.GrA(XHy^:( Lfcbj)<8MMMWޱc| . JaςǕ+WΝ;G3g+ fϞ={ݺu/nݺ./{w͚5TillŅB+ JD*Z7|u>u5@*v 4@ CPoŽ =3@l!Y+g|5{I7ŝ}XP=ք&¨Qf]'x`i׾"Ue]=mt ;9BDǩ'sYxϙ3gK;D@WgҮm/(҇sR)]@kBH)ƚL*dŪK:۠ aPF ad}_,Yy{.~'6lX~/4׍C(9YsvvO)Q:k6Dd4%!IF$!jJ>ޕIKlڴ)͞|_޺u(z'O>tUV}O~t8sLV !X#/ݻ7~_GA{lڵ7o{_x5k|ӟw{/\_W\y۷>|^xg{zz~=zt׮]{r/wݮ{>CsyFGG9u̙S(zzzzXbŲeˮ暭[qtz|||ƌrWG}EQ,/#G̚5Eַںr^-JD4uԛn߾m6]r嫯m۶;v<3fzꩧ^}={< ,5kVkkwcǎwy}Ǐ? .ݽ{#Gy䑎L&綾^+JgggXliiq]ő#G[lY~}SS6l8t'BHztۚ5k~͛7^tE/,X"wڵG>+V9sy{o~\hѣG:422_r%կ8pر-[\vel wze4@ 4 h o'UrDj`kZgu|"Q,\IK({zB (119#U9Q(%(W( AJUBE@ XT&x2%gC-Y)P k%菶KB9`sj$m8&*RN+>z,miQ9DMTS(x-Ҟ蜂L 1A)V)#e:jn3¦"1i'J%TJ`.%2n:-ʺEωp  3[)(CDF>9ͳLHAFqB W|Fy0L ْ|'BW)鰕.LJ턘$̪!,XD٪3c)1#Dբ<c]!0ضu-ͮH)+q RJCic%"QXmStpyˏյo߾W_}&&&\׽ꪫ$E:.bboZoܸU*믿smnn>}G?Qb}.J ,җiӦYf}3;wn\nmm>LD}}}K.mjjd2Ǻ(q/}K7offͺ ?SDR fR3fذaJ)??fl >7nL۶mlmm]x+[[[?eBO~rʔ)J% Á[neϞ=b5+W .h---ccc̤ϟ? _~a&a/Q7 z%K/tŊRJrQI,%K>ϭ]ի/r``qRi`` rRW^yeP-ׯ_tzddꪉ kmq1 h?B47ߥTQYnSHآSIOʁ $1](DAS]U$Q-zˉ^zqplٲe섻t0 mmm)׮][T<;?,Yd|ӮeI7H:xρ^qp]7,[؉g PJqƵkזT*d ,+?Β=q7\T1qVõ/]TJI9e˗/7o^\.]]]⋯ (a׬Y3sLY%">`r0c'AL~ccq~0 +'Ǚ>}Ur?uc lJx0xj@ ~A5@g}[o %.ƫ'NNS~S2"N-=T]#r(DPVM#Wg5@@dZM9,5($ K`vٸRB$Hse<'\]R1*V*GKa,'-[=|\JxJflA|1ZGVI.0,"8 HJ 0p]+JQl !:jkt@1kRRWk|_+DV*G6BiH Qhm:U}NC5bmѳY"Bd*xo(Zch( (ԥbYZe)zJcKRl6'Jq(TDJ>_ri . :6??sC`#G:wO3g!Zm°J)/w#1z1$Dy@׏ox=ߝxRT>f+ јc v1s9wkOEk IDATA ޽{lry}[^RիW^RhYP3Oq`s 1Uʤ$W#]oYv 71X[fBzn-_'>1k,:^|0dzDfxpc!!7S1-J[D0 ˮ 8Z6ើh^ ®~H{~tWYlAo%'N85ΙPj/P*"")Y d Ղ$ ktAz1Q8[ʱ/p\(W QEj8PdRʕJ%!ʪ""BI4FkŨ!H! k4"*8,_8 =E1d@:46֎hMs^RE E:"-+:?B#bDa %j"IdcDHDV)Bۘk A"T&;ܖ(K~Z*- R bJ˴- VBbY 1pSDd҂KZcUֺ $D1n9%Ye,hAaQRq7#GF*QɃ@繄(ku\Jtt(APä| -  RDX2Ur" 8R0&&YfoX( [t{~%:bFH^Jqѓ* 0.ػûw7p5ޱwe}DJeƃ I7UX*]p:bLVB͛)fskl&Ɓ"F#!+D XK " j$kXF3o%$#n&J8$4\ibD&wQJ1FLx3X& e$H397X |KɘkK.'c^U:NE\;N]p _~ykkӹaSNǣĕ&E%( t9b⌛LbNafj~UO I:d-~c[zu[[[oo/ө)WTďJ%{m?x"("Tyr17IhxWA5ν+{W_}?JR]x9?n=o}R={{"hopӧM㒷47;%1>f={U_[1ARkw\nݎ;?}MAq:fΖCۄC'm/?{.d1XRJqkm8pє2Ħ53Bd,Z et|q#= [u#{?~) hWWO-oA^Ɲ1Wy;.AmG7{` Гc"{-`5˘8IA=)2 !8QDݠ1FT DDjqB@ "D$),i0ZGQ1 BDcJD`-hmML6jP)0 չ1i $k;v$:ql0FɔTgg2ӛ縎kt`:B: 'Fd>,aW$D]kbMd=#[<_ֽrv4idB5?&CCC===I*+cLAPX-H;hӞbHPL8p\ߑ~> RJJ12BC1eK/JicAdr]Tbɵ@}ADD^ͥqŊ5^:R(\Ekd[zk ^)sBqt'`2mLE8S|/J{֗6 YD6ˉx09TkRr9Z@VUԤvqs_.$OQ]5_&4D 4@hv 4={o-9榦}ot:}kYiIrraƷ%bOϿ}Իg@2j;I !e A@=j@X#'dr񖌷jX@6 RJ"[ \86hk-"k&.*;UaB"J@U MaK JOG#IK(mbm" NZڥ*jH[WJ&N@,]k~&B"CRJcQN+%@@V55!%2UONG45]C4A""3-?/۲$<'ao}hăְNq$tRe }:aٮEn$?מ?{o$g}[Y!%įqT^\;1obob䦸쫱@ $!@23=K/[iر [SVo#=MTG􆗧i:F:yܹssp΁b ͔s.8h1(8SĩM3ùB A{5<ixa1_tX{G ]Sg :Z}֜9੃Y(V8ڷ{g1ƄhH5H:`A>y?cXg669+ `ű7g^ñ՟k.o1Ӎ'h?|<sϻ}] y뚥@n-Jq^WR$s̹0ᬵ.~VGQ JzrصRK-k_\6\s`r嗷O_pxysA\Ŏ1{ϞY3g>qcs "Fq )Sڽ/V}f vwuc˯i oDDȈn'Xئ͇V`2F[(7sKHF3=\jz=_qQf4o59n=0wHpc=miLk#&-T3%ZV r9_z231:WmM%^K- $@Mb.7mt,(p@W"#D,,q6I4XƘ`v\NwJB^dZJ90F"ţ/ءmN^^*se' p` Mqf C|!8U4gbc:`5 20A1( /X1zbE@x-4^b&E0f5GN6-}<ƘqˮI-_6 qԩGg!isՕAN A2f_( &IW_>ISW\tpehًWm>|K PZk =?ylw 8@4#kNڷXKl:Ko7U |w$]]ӌa蘚9C\3DuF~v !rֺRQwww{{ v.9H'6&TJ ;vlpppѢEBKGZ FFF8T*ӦMsiBn`}Z_T|ߟ4iRTjZj~sv-Ustcl|GxqSW_y像z?/뒋/=qnS-o:vO=ͻ>6Ki6uY*nMr7~eY&%uۈ8Qcdr&"RR6Мes ȜR4%.`d"2M0 CCC m4ED$IhX?Ϲ,qƱKDh in"ϴ'?)c4kHr >gZ6LJkISePJ)爜P9#CYࠊThC _1`mʥbo,#`qc<P8kJO9qc yFYkӰ$X DnM"k>|JF#G?:vحz饗r9Bu3\WlEO>ӟ~?uc|^n+WuWh]K-RKjZ]Y5pego>n>Nz'S8wϛ7F(0RRZoQS/$XL5 (+ hY& @"eъ/yYe+5 IDATBVL蔒r/BICQbDg$6CʈtFV3Wa/XixD\g0:,ͼ^>K:ږqa(po1c ܘ*說!"F`FCkdE``ڳ 5ihD`ѓ!m92{gI*8zZ> uE)mzH } :bV-KBN*z\kdF8K߂YUSclJ<K4淹޶Ot9f:]މ'},FGk024/2!0`“w;^-%y:0 $i=;.W=3'VwxyWTWWgY@nzv=HNQqၵv{“Gw}I<\7e|;ԭoĐ9ETJ90 ,rDɑ8p^-Cx@Xؽc3(օBT1M|0b9耗#; nNnhOO7mTOpego߾k^{J$Ic\#4M\-jDDt$+)e>VafYg YBDQrB0 EBhAؿ믻˗/[̙gtXa;WaI)8<韂 l4nޜ#R9s:$I\k=I.1VVKRjG)J&Mg>CDiO>y뭷~馛ɖBΝ heY$\z.{֭[}nՎ'vo"ZjZZjPknmp0cxozMp~3iK5ǪZIb\3pi& ,71AR2 B3\rnb1CF[Z˹) DdSd/ @De(,%YQ(Յɵy*)8 2q%[yLikR""HN2ZO ,""ӁnN^L%A&E8H =`y̓dP Bq׆u Ȕn2LYc4YEGegY@-uuYn;n~(KG-XP= ˬ5dQI?CUPGTҔBCƴ` `Qi&RHN(nh^oEIo!tA=#0ȥtМQg~$ɮ],㾔baҤZ3z#JrX4\e ϭ"<.2ΆjQOxûw8ygI@+trTB>Im=Dez-o GFScG%`xp`s q 0֚{ 4/7@5kmEz=gY:F0tuU(JXEZRa>AΞ昝ȑ#Ƙ^ι[Vs3G\ j$Bb#b/^EQBZeTZuv oNJ܅Ƙz^wE(ݟ{2e cP(Ε qScKDJ)hhJ 8JrafIK-RK-Zj~uLxn2~ѳD@mZ93,3Z!#`yr F`<#rʈ[ C9[kFL4cc?G`rQ2ʼn 6t|xܹ7twߝ$cg]wݜ9sرc3fزe͛;믿R<{]d'>3fTU6o޼~zGV\yKx>6agRj;sϞ=+ؾ}:;;.\e˖uYfɒ%/ݻ(^{y7<<#<ϗ偁niڴiъJeݺuT*W{硇fϞl2WkVgy+袋K/8qZx̜9k{/͛77н\. 6m /h;::.򾾾g};z'og |bEq@R(!H6E&{ayBk'^5yioӦ8R)0X=5q;DDFD@րV֓>YС>yg^JA9HRi笵{1m YLJ#iκ;R .PiH9䞟*c,;4SՒ(ȇ/H d5΢;@>ĎQ;::N{GyZvuu8qnۇLR*744/|رc7x_/| ۶m>쳷nϞ={=|+_9z9眳`~?O9z禛n;wz(O4iƍZT:>fYVq\4s1ޗ_~^{饗6o޼k׮SNpsmnSN|͋/|~=֭['NyÇ/>0}tgm8q}…k׮=vW\.m۶oMurP)9;s~7Ao}kӦMry޼ysK.袋:::}~FcӦM?{뭷[ /\jF1a„ٳgoܸ;tryĉoqڵ|Y7t.6^|o}[?я>|^y9s\xᅾ,]tܹ:͛7sLҥK/^ij'N( _~]رcر+W_}|__ncΛ8qb>5k֊+Lbi4X(jE#35hMyG'>J0GXYbLblpwT?>Z=ЈFtă1X4bzzlhD3>-o+8r FZ"BkQɢmL# 1ئ"pA|EW/ ,@FZ!tqMNıJu Re͵qΕ2\J *(($B ~(LYIA 8m!C#PkӍ$<i]gb4IȦmmmA0r!c@`P K:Z^tfĀ15F[Qx=j$IBcO{3Huz.`LG%"1Q-_|kDsyM4iʕ ,;{>}ng?N22}oϞ=_WL9_bţ>f5;Y?}쬳2=z_OӿX|yWWה)S.yE8mڴ)Sa8q /н@ۼy.Fk׮3gΔRN>}ҥfrʪU>3fkK,YrRK-kZ;ywo̹dV)P c*tNfǪ^6*,䠜`$<[F*d{ Slt~@mM(pYEa>]o/=,d#0QRyQȸh+iTwltwjQ֐fIe"KT Fd7e:155!L,qL!4,1OF!"9N,@LS~n;> e e#&D:($FHfϗ; S$Ltoc2yfHE)#nl`bb5p'44Cq#ڲ7Ӻ9ބ-_ƚO[L1!Q:(SN +F !'Gz;Kn|Y[h$ąC[YJZYY< ÞNa1ƍRƘ,a>d$A")2J5Y +.!ITn~B3beiDcߨ;{Ho>>;A\*B.˲,Bp%u]۷o?|vɒ%vz-Zs /6l0y ;o߮Fn{{{'Oࠔ\.7 gۺuN4 0r]]]ݜ3gšFեv~.E"*k׮=묳ܫ} hc=ÇC j5%]ve='M$Ї>t{N>ٳgJnappZ⋛6mrqI,\X,__~WZ#I ܧ&Mӵk^|CCCwK/DZ1ƭq9avww7+ҝߤi /޽Z 7\.KWJ)q3f̟?s98q;'KxW%Ks>Bnݺ??sQ98::Z*$I4r9)y.>% \.$ԩSyʔ)r򩧞ڱcG### nʡR`7ȴRK-;kZջ9xA61,1dcRLxz:"Ʊ@{*H9dPa2CNVղFU5#Yϊ9LEŧB 'i?kEAtSP{yFEil|j&)d3Es"x[`I 0R)4MU8.1 ,w۽!.e D1VYxkЉu͑aAcyR\8b!1YL5¼j!(@N“::hei)CX(@$-gdA-̷^\2^X6 6A<.<"ӈr25# q,jv,1@@!K}DQy!pJ β8ٱcG$A!2 膵^Zn$*'Fg<EB.ii"$bhphPRbaQ\L5/3xC#Ƙ6DBE,#Bm*cYr-=u<\)Xkk1D4{s>|gG^ظqϯjiA2%uG#GU%…3iV*Z6wE9prsIƵm Bc͸+W|q<{ٳg;Ѓ{9zrϟ׷xbD:uj^w޷Fʕ+ڶnAo~>iӦ)*wҥKgϞkE/'?y衇xO}SԧM)ƃ>XV>N togYV(\Xs+aÆiӦuttϨuWT*Ǐ\A4"rC|35N$ϻl G?;;;> c04;gAe.r`ut6m۶͛7/\pҤID:\!ӹ_4bݎ~ퟕZjZhZyI TE@O22 -CĔdxbT{&Q˅;snjQ -ndTJY[2jez"t,NbYF%<5C& pz*FF=0Y籞⬑)g[H^SCb~@Rb+3qzzz jf!U^ 3,1P1"1" F4A\@)MƸ[J`i=NIUehH:c1҆!^z E*GaOiI Ř)/Ydaj2ֈUȭ/zF>}1֚ ۮgyI&!k3BZsP!1iʍ1 $-)AhZooȈͪCMUF[bvY IDATP0dXIsA c 1oc%3Y@vi. ,$apqGR1Me˖?~衇5k֜䓃Ymٲs֭{E_|^ziB'x/<|W_-FcZmÆ Q˛7o>쳷mv Ԏ;-Ze˖֮^_Jdpppƍ{g̘122u-[:uG:u׮]{}:"z#a800~ f̘o߾իWϜ9?XhtttlٲeӦMRʭ[>As94Zj~v-+=h,?8]$>#GMneU[n˞ް )?qs'NxraxՋ9m5k6oh4+I[n?[1N띶\\w\v=?uwu]qeSLy sC}κ`xX[]?1cN7L)TL)"--6Ck@JSC0fFPy&%}[e^4/Km"ybf1"X 56Da<$U ҌLp`j!KT#V`A,$gq@:",5Y&d:3H;Ocs5x K@ %DYˈȒ40! @Rb.Y(ErH6YhmX4(kTy'n$IM &Z Ȑ!Rژ d(dhgC BJd wƐ L[LvcecMt:+ik5x]n6w^"dD1Đ; zC) 4°!eYfs!%W0I<1d5  (KH1VSr0[BLca3 |xLwO-}m{r'> 2eJ$7pCR)g|衇* c?{olYU?Zkg4tӌ4$ DD4b4j/TE|JLϔJ4 !*B&TfFs;szݷv󭮮sg^t>Wviyk.]*+$+6Iw,iW]u93/~YƘkמuY5\#0X⪫kcO>wׯ3q<;;eW\ADK,tWDu{\s.˲>OOo陙#8⬳ZbD1q,(-[ǫWnZeYs1J4+W~曫j4_~eYkeȉXkO9~?DjO?5kEQ0󩧞nݺqԅ^833w^k >w}򋄳>֭[w! -b|0hzk("ZLN8oU|G~?75zz;)?'|?N<>y n׮YC[j{5O߽=Os ^bDf0C6S}O<#1N3jB$bJabI&3&RJj@7LJrZ9UyU&b7:lLBd¥C̔F@)sT\u=VyL|Tb[V8b { !+'b|fZ=(+rȎ|12:]EQT+|.AMU~w2RO!I94;=)h$U+*. v B`.jIr]:HkdKHcDpJ?UA /$fZ<9oЫ群N<#(b&OJ{4**%#,z].FoQUoYTeБ7`T`,{yAhª64I4uc 11jj@FPZo`Y1 QJyy"><0{})=Xԑx+Q)ś)0\jW_k.Ȉ䓖eyyIK5,_jf׼F ʲZoذaڵ* ~P:sD袋Y6N8afffhhh͚5w\mZv[.0SO=S ]X8#G2{@R^"܇x!A33"p40}esҚ~$Ъr*ԑbJfCF#xMA\gJ4I8+&4MR{@D:(e0>446{ՈQ2͓ P Yy/{#:{b&}3KW׾O.%'Ru#\} ZͲn/_\:I+qAYuCILD>0 ;&"ΥH.)Zp=f#LMy.4JV+DX{/ixxXmݮyݠML|VK|yq 0Z,e1,]TxeqZ-ɺRYG܊M,D$熇$J8!J@ىCӑ(lQYv[~*~oHk$9kmi1v[v^u/ד1$"b,ˢ(jr ^_񪪲,1RN#JY{<3 4@ iYpeYOZ/a0SA?5ūe]6Mٳ{ů7 s2hI~K.Z_=%xk0?nqx`}ՈS59BI;6"l ΁yر+bE}0J'+d#"FГB U jp FF,I@yn2+y @Y *'y D#hJi+<W$ DuFQPiZ4 Ӳot#~Oؗ1%RjiKR13FML; Dι,`4x7y 4M#rrHhFn6B<7ʢpS`V, 4@ 4v ۔RGbyѺJz(_7]SN }_5W~s?o$~oY5,{ȉMo{s|1k޾3'&w* {GN{ozJ02B &Q9u)@L4vPt'MHؒr6Җi5Yjf}$-˵b}` J2Y2H>=p[•͑f̨lÉjf\ )Dd+N ,X(`E0ňO1{""ؠuJ "fd6@aNQ]U(!9+ԨAUۂ*Dg+#ق=̖NsQ)M 0+ ,8K Pzo+&*AkD$ v 2B$XC$|5@֚,.4TAFIRT%5ͽsӻvڱc[7kmqwIHȖ6X!cOY1gLl3 8j*Bh' ܅U1T̬H%oUyO,D LaYZbt"=C ^'dQQPl\jʿ,uUi$IYRw)>8SNGWz5ےcQ,Y~_l, $AB8gX#K=z'iZ›ʲ\|ֈ5}r.Y0Y\!LeQ&er'XMAȝZk=KJns2T^ IDATҾSPz퉣P-t{br&4PV|ihdY;r QBEe)9d 4@ bNu~KowyQX+?Z{1{%{_~\{1V㮻~#D,ϟ~A[㜻.]{??C{{ȉJvy*$d5hj Ѡ5bP<_ jF@) 1t<1BKhh]m}eiq.fɇ뻽I0[ˉ=W*Jo,M@/S>wv^G4V[ǍdTߌ4*.;[3m6L6W¢Д !hͬ^U*:6RtJ-T0A7rjF1AQ*@)@ +XiR#w{ck"RoeTU!m4ʚTУJ)0!B!bD&ԌF'< 11[p`*F*"RmFyM:.c'#0PPsDV d&gmY9"0*bбF 5F윳&bW"(Dńx(9McDfAD)8 4#$qht$Xlv-S&~ij٪%%#KG33I044h޽i ] TsM iQjY c70Ȱ9nuT(X)HFDA1BОre^XB ֚!1j@ jQk@B=0H!|ʐmk^k@RYXI1hbX sSqz@u)BWDqqlɠƲŃ@@vqW Ð !~ ' ؖ\&G_YcMaVU%կu1^# TŌXN\J)9/rVK@ !4( U8(k(LVcUUbTi={2c5דsgLip 8J-Ђ_eXh腧n~:nݺ7\rɷW_p7޸eё7.P%_|w[k5~A/[?$Gij]}Q^r{ȉ}E}w#Wi|zHO ewΦ@P8"T20a}nG*lc#T3 }Է\2W[PQS$~+,b Gc=CQ۩ct"K_v"h4F0<[f~:ݽk*cX0YXyM ;#;\g!V'aŪ#f\Grzz ^y)Kj ˔3/jm0VJp9#)gcPfQyqbUY|7y * @iEgF BBFa@dhVA frs{A,`c":o/h`9&٭ bꢰe"06ڒRTU E޶yOfP6q"|ƭ0ʊ2" Q6Ry sILevC@ʛͦRJҐqXtAVC ac}^d ,¾ivQG%5|jP(LH5KzC%#(9S_"b]Zc g}2bNZ:Z /{[Aqc.Э6޷AQ0KUU8p 6q3 ;F3v;wyA jZ:Nn֪̹nfjqKOuzhI "Mթ<_1L0f9ot[Ua׷]%pe:xq{9 jB`EԨ0+ L 2$kfd0h5k=X)059V멼'̀bvקP9\ 4@=z됿~Ayz؇+:"`EZxI*Dy{Eipr5af.ÞơS:KZV $H8*$l3UcsLUNQl) SooźXj^MZ"L nNt>z  Mg6Vs8pJ9 $M}k2#C' "b8߃ X0HTwDohݘ!94X@/ 2( #.N8hQ!TH:A֪*8;;V/}0 G's,&'~!uj==9ZHuGeتu{mu^SSu}s쪚. e'gHhlEUH3Վ`'*UŞ5k ǬYU;$(NywWv@D!gg/=> 23F P!xfFF0 PE ^]K5_C̊VYeEMe}TbA$`;;d>xgP ؖ.0 @WBZaҍaQz$ԁ҈X!7Ҥl$J4M[i2::\S:HF3ygYO{K EZGDZ>Si!r&0Uv*Ui ,(I 0. q!Iwuc>f>kүM^K}X5%6MDDWuP[Y.zXNMIcAk,3 C ',^KXI1N #fyڜsy7 \;l'thnťTPp@!z s=VMl֓ VrZm+/v zsf3EL e8p۳˲jaCQee숽֚u٪,Qjh=vvP#cN<?䓊n-6J)cY3Y2>K޽{=&̞<$"t0t@Mby`q\eUU\$/U@^ }F!8lwX i~Z<ATg.{ .Ib١:+9MKWA\ P~%uڻwoQG}(N9Yι۷ٳ'#<hŬhzq`Nmc%`]jXB{b+gCmҒ]4i=4Շ 1np "36}*-K @" ^W~$uޜ>DSe6lkرw٧r޾;wK8ccGݳh](1B3a573mmޡUU WpJP@3[N}61^HE>$Ԡ4rLEu])\j 9D0RRkBm1FV@ P+`R!Ȼxb3p,w5*M3Nhssp~,ZoLb/rJ{f&:0*04H'={hQQ*`& rbF%M[$I[E1M ew禒6z5*mY5B`*06@ nBʹJ=6>6񉫮z=gΝ;o/}K[nۿ۷-EQNh} @ 4ЋN@ӂn@=݂89WPLSEY=U66ŽtXMáҬ=;Ԡ4(;3߾Iۇ+Ra4ٺ=xeǫΉݙFXl+0T}k0M m~wou`*@N) ¶}hye&3@Dj?^6`p8 }fB%Q+0QDX)]pdcLQ8 Gvn#Kq7yfuFA5R7ݹI1Sm~Zù4M"=<6#\==9UƗ-ˊ YrUQiQ:K *޽SYVqheeOs~ȩ~y晝NgժU/yK>ڵk!eM7e׮]AOefą'H mEr:243qg?I:١44buI9;:1믽+VW_׿> C)5CLh2߾}kcUYfYVJ~, ""*̃w־ƒ#1cm3ϵXe (CCC~?c"*RxoƘ~hmۂ XdI(ZVUUYEh4ʲ'.˲4ukR ӍF#~Pe pxx8Mf w]wuWկRVtnnwnnN*4$IݫND@R 葳:[HZiە,˒$ܜi*ӕeY* ,"9v]g ȖB$rWs8EQc$ڕyo$InZ;77g8,b8UgrFCk>|H IDAT]s{/ٸY9rONN*FGG4|/,RJ8ohZq j&n4ݳg0ss"ej6ZYYHs9kmQa6 fβ,""jnwbbBUUAaQgthnh }43kIG.besC (`I3eWݟ"UC>jdx7UL;T1M޾5fm(msI=VFr08E!H^11^6iڨq皣K^7333ַ@_|'ڵ~aÆe˖wqg7qzz[n{N;??XvmeeY^Ym۶o~g]UM7hէ~w߽iӦk欳ΪJB >#Y҂ ۯ 6/O\sss~?\Ԇ 7رn[w/|aoxN:ٯ}kn;<<,E?яnUVx>ݻ/]v'?9c;cڵ~7|~O:(&''ڵkff_xᅯzիʲPdQ_Wӟ6 6\||7򕯼;7mW^}6m/'ۈ.۸qcv{Ν?{ W_=>>K;~###?xfY4@ |_-Zλ[#t,od'S]w?~gy/T`?f'AD1ۡF:H(L"[ea s޹2wf0Tsae0 JwՔ?џz"w}t3>)4].ˆV,k-禦4tr2*]XUY֛$AlA#Wxy}yiL OFs1i犼[k=2YAIHIS=W"֏ qpJtu˖8dUh !FYC!6: UF$frޓP!p12ii]fq<A( "ŧP&kDaabZ0ֳ(ٚջClT{#f$fDXUw,UUe+9Ũ,sUldͦa[ ޻—2k~75՟g}*cWF%]v+eJUAy$o  ,ez*F&裏&wOآf0)\M'{ʾu⟪(t@uqw:իWٳ뮻njjjҥfsׯ?K.マ<}}_ܾ}ywgp }3{WOjs$'|N9WUfS,Wo~~wg>sw/]Nްaƍ{޵^;11qe]vew)˲kn۶~ew-l馛ntItw]<X{_ׯ_u֛niɒ%CCCWXl٦M>oٲoK_o~_ׂ Xn]ӹ/ ؽ{>_ڪoSNꪫ֮]/+_ 7CuQ+WܺuҥKO8fym}_4\uUD|殻/| 7xqwE=c8vT-[6m#lڴ{ٱcVH"رz+Moz_x|'m߾=I+Rk77wyg~~^zk^n~]w}zo|/f)Uh^zt]wܽU|suw_{F#Mڏ|#͡_$Z1O@d&hS=1{҂+x0C}{zw692M1r\9Z{zᐜn3Cq_E])KlYvv8 / bH7 lVYbRP2%12%SER\D )VLkDr^;~@=5]UnUL9Z.Oe A&m⥱K0¡7GdT>{ކutj/*W M0g S0d s(dMZzڃ,JLIRFuȑ´( imoɷBG*_|%թq5kr..!Lt#tIq%`q= q(_U==U98Y>_K *xRP*[|1}ɓzW,ݼy o8pŋ>?sw_Ek׮- ]]]7o޺uΝ; Bek֬seGGƍׯ_?00lٲGc/_ۻs΍7گÇ@רOyȧeY|;|7آ8N$Aq۷ Uէ~Z|+VXk5k>cO=-ݽlٲ+VݻW^r6lԧ>GGxj.\3gΜ[ne׮]w/ŋ---[l/^<>>/@)'тAW^}W*sqjTڵkז-[5kvٹtRD|î\lr 7\wu^{o166&طo=300m۶yڵ{9w[LLL$Iֶt={ nݺUkiӦ;wnڴokkV^x>|LKyϑyJ_~x{Wk {5 \x׹!/Xছnڵk׭ޚe/N^c@4)84Zkm01iZhoR.;w^.{JB(%uGk[5х8%eD)ʴ'K3֔$Il@뺮Hdј Sw^#"ƓR A`݀4g/ܛMIL%(yDVir9q"AeY$R\FQ\?_׆$"n=q,<q>":SO=飏>+p,c^KKKkk@oo8ϟ:uTR)3;w.*g|Sxbb⮻zH8`]|>p=߿QI)WZ%?0 {'|rbb'(joo3+.]n\VJ ڕ+WvvvFQ߿|}>|c{޿˿wwlSM5TSM`TS :GckzO\t>_z'|7b?Ix{{]?=s۶%zc{2zOS}/~ WF_߫;~|hppw̓YȈRꍑysN4։%TRI !!Ld)@r(I]w +!d>eWI%YAJ=8UNEL&ɵ+]ϵpXOL&Ip h[9)Jȳ& 0EEz+17t6Jq& 1FTJZk( !`PiZkM!2Q$!PRƧ/]E(?<DɘX3I"TKiR$ΔRH( HבHQ&YRi-T6$%|޹& "GpS+֬YsرGy[o}Ǿo޼X,NMMMMMy'㘓RKRZZOMMj^ND.$"5$I<ϫjwuWRkz{{BB;q4m#" )[Ҷl/}K___ڵL^{/]m۶{rC:eW\v]wѢElX[|/&"!󋍽<0yyuvv6҇Ϟ=m۶4Myk-TSM5/~TS:o\t)*:ˮJ|ٲ'N4 qc'Ntvt! ;~[KR+Wֶ-[HLݵdֺ?r0-:022r o믿h+ɓkVRJm۲c {Gm+e7YhQMK`R9Hk K>2fAX(BS@E3_oϏ(:;|GG˦n٭ݭ \ڱpNՎUuC][ZsYtml]0E[o{kWr4:Ν?HueWA]~3z6hS~=pTmޒ9Ȭb_… gΌdi``v~x݉'72)BD$L]A J9::1D"d Hւ(RHH:*TBb6VcđUKzdzX>WNUfZkҙa/}_9 Ħ(抉.m UmІLbeoz>g{af?` !|wgM_x*.?J!PJQdƤiidi1q0IT'Iĥre<T9?W@ǑsyxܠD$$ɴ1(HR- L[pڭS j%N$KA /4p ٗlzwf鶻ҽ?ԩVq&pyW}p744tĉzzz6>>x͛7}pj+2}͜?+_ʃ>|`ݺu-b!@E ؎[ +lݻw3y7СCWկ~_nݎ;.\țRrB.DÝ?~Eׯ_lٵ^nݺRq.Tv "dT?ٙ.q^:{7ر3v8$m* BV)馛 _y啥K(뮯}ks̹[͛ UI"h|OTk=001bHDSSSD֭O?>1_$lB: IDAT!)r^xK_REV\9w\F ?]#C'}!k|NGk܎p```ժU˖-۱cǎ;؉wkVe2gJ C=]fMPpgeeSM5TSj:jV/\}'x(<:on/u ¥ыo[?SWy͛>7Xᇍ1/]?c$o=ۮ4N~B1GC].m{=w׷%ϙ3 "DZvTAXBtک!P+!"(E&Fzl5I7JIB9ZE\^,,r:MysemgKR ;_jpQԄmm~w>( };زx5,[imdqۮ^ZDI:vq|ը%FUtJE1 ZղL54ئl㴆A hFcswۍ 涕r Ɛ1. B0/|Kb YѨY $!$tVO2sL[[hRaKXBA4UK 1B=01 rV@@@H4ܜ.\tG&EO^cDEjRyn226K5MUs"pL412G؀M3$ X+f:I !I4n )`C"DR*[u=cRDTD " 1=G1ͅɱrryH QgWUj/8 &y6S:TeZBdiBt HXA ڤYfkDAKH4h,Zc"imjKca9NQ x;B6+2Bb&!k{}7=koo_fMggC~]Ju]77=m8΁$ٺukoooE Vx/oz>cW_}uzZr }6?Λ7oc W6wBr.'NxOO1 p孭gϞVn>V*ر?88uҥ,X`Ŋ|Ū Ÿ|,2fma5>> /,_|ڵp$0 "}?8zeB! C"ZzUz~!DZ=zŋyO<8D\ɰw}̙sܹ#G oܸѱcǎo~w}r9v1w"bF8=z+V}UW9}~;ygoV/xSM5TS0jv{a|Lk,,Ho}kpɒիVJ_  :|3%>TwW^x󼞞{zz: 8Jw(.ӏ>k>|=?߲_N!2 h@c1H Pٙ2SqA% iuL<8nj=͵֫S;W\;(<1Sx>SՎ.q  4M)hwժ: VIgeSR +"qqGB"j$FPZ_xp \qy]]TFLp6ˊoG4˭y*!F[h:NmjA@`(G! &H@9Si4oW9%FT k2.cv{V,?Z] 0pF$26 P¸(K2,H-EldˀP a,!֘ƙk:#! A =2,"Md$c[|5h):JU8-eV+VsS\!'IuZUL+=?:Z$[ZZ8VreI@HYˬz9ZV(, EH Pp@8: Zkf BLM@8fs8':JY`;=xbRz###{oDq7xcO>ȈR8r8p@qAN=44}{_PP(J/V'N9skmm=s̩S;w^. =[~U,cRfzG{rooƘ7~39ywߝmFFFi۶mZ멧⠉ ?+cǎ7lɒ%Dںz{ĉϟ衇ZZZV\iݿGGG|o_rɓ'4=x O8/yƍAxs;ydZWzm^:˲۷ rxH.ڷo7MJy饗y?#O=Ԛ5k طo_\~'~~k߾}wyŋ{9u?Os֭[0.b7]T8ygyflllv;w~գGy睟'Ν;կ~ 7!pqt^߻w.]twtt0}嗟|ɋ/>wnݺu߸뮻xҥqs~Ydxמ~/^|+㖖s7N7qSNrG}tŊWޘM5TSMvM5?+R^wCR.ZɓCCYh;ZhXWgˇ˿O7 뮻{_,^wl ?[eCK+׮}g߹y~۷n~te#^S q(,hm mXHCN3WIa򞨦i(rxay :|XX"#\}rdȱ˗^έW&1Yǵ$:|ܼe>%]t|̲f7&W&&!jR(R5VƉɒ4JQf$[48pU {{aډ=lkw1)?.g?/Oӈy^wwooϟ??vN͝;… i|$In$YpRjppC+WMr1&^֭K/)ϟdɒ4Mڮ˗ki !6m/^lkk, :000::===y{mvϙ3cq~lqίMӴ菾˙ !0ZkalYqwuumٲO7|뺣Zjhhq+Wy{{;͛:::|300p)y6mҒeYq 6uttpʕ+?sɎ;pddիW?3\X|??}gX,޽ TSM5ό? jImm+Wxnkw}|\s߷}̙ w-};Qm}{}_\Bfժ7Yhѣ?M.Xƹkǎ{=:b~!n<н< 33ڟp׿ j#KdA YҖ  $)!2 dPg4fEksae2) 6JzF54YV˲$Kcq5&IHJxĺ]&#I"mINZ~RCf"QV93 f"OXK8Rۮr,5PB[y ?{za5D=FLl||+%d)%\._(]OY4y_@)a-mQ%0V 6 !%9"#R4Yk Y`6dAfqwD6_ʹ{m8 صkZJɽ֭[Z-?a[|֭[W\z͛ "Dܾ}u]g ðX,^z\y]ZJEѱ~z"A0::dTkk+ןr;vܹ{nu^g_j5"7nC---6lعs49k" V!ҥKkZ4SMLDw^uk-gF(jT*J6ذa؞={<˲/~\r[(nQO[[s%)"^}\u˅---7tS>_k 7 }ZJoqΝ\Z,.]ʷX_1z9ScLXܺuΝ;99# g}0 B|||< v _ :;;A099 r-܊Nknʕ+9hZiӦիWs6mRJqӺjQ5.>+-[l.oeojxa~} \zڵ>W)iokk|9o9\.o־|6x !oo6e׿zk nngZMJy D" ї&@La|N vH4ba"Âe;}R sB2Q?!\*Grd:Փy:F+"CH4dL=:˗붬Y+VBM*$hǪ|=Ξ%Ξ1w?d2Ec.@^8V֠Aa:VxO{EÞn7ڨR vyABDA8ƂC Qx9hc` Z `d* Y\ s,0NJ)'syO `eS4'PJD dZk)kkIJR#tB@k!k('[4ziĩ3~[\1L2Qq'O ~?̄2-uyVy&6zǙ!nkkkoo7TUvr `;$anogjR;K7joooQq`n6$0i:_P,(I,Zc,_I< l#U{1,T_.e!Z6Jܼ?q0,\CKS"jʬ "o6n v*1|:4m$iZיyc=EcLooΝ;-[8N\eE3ZksK)VL(2&ez\Lf aKK "6roa&e(!c&eIxǬ7d1$I<' !+OI6 Cj`&O p-A[<]9r9~|/xLoRr<~$[2JkE!%y7@-ȓ|NqJ/p 'R8H_"r|^c|ƅW;9s,mj ~!uΝ?Ž;?kj1 ,!M2Z M*'m,!XcVSn0ݰ} tD0U((I&LNVPOpqU]3S056.Oe6Y4b`mIb)@ m ʛ$I̝d Z?hˢٛ^ye)y=;NTǢKofl+|#gTiNvBBD7KBh%6Mm,MR:U P.t8es@ymȐB' a /#&A h$TΑ%%q3$m :@Q1y$!ZC%EtLb:"v2oe:DmL 2U.#$2$2i0MБW0^}*1GT[a :ZsJB!PcM&=HƐΌ9 ^;ajaIXO@BNG IDAT i infII"BKdZk 6:m.R+|Bџ8rT*;8г1 *)%dr9;i1:Gk-s\t۷Li5A,Xr\6+ƂYƈ!{a1/dAq,$bDa>Ws38`I P4q&}؆;1}͆w ?CDTE2̂Y*lrj:øyT\b̨_Ƙ4M `VV;a%9 N3hR5B c͊:'4%2dDB$3IuqJ>w`lҖ֭͛d6II9:5QX L>'])[HxdJEdUx4X[MMuJ}k^K/\<^SS'#,w({ЄB XBXb;[3OX k*bYl J$2DFec# 3ε0"J N JaYO` 7F# fV@j@X rT cC`RVCJQbk:p:Kr$Hgu|zDD (${y('RGr !DFa, JXLAJ8``p0\; /QVn\b 1bA! :B#J`""<#@ !r_\=jzI%iVK%S4Mɒ n6:X$mg.bX|k.%(?<aN8dT*lwu( k!S`7G.en,r+L1b3lzfyLpC 1q] _|L@`![x0ʵx9Wqt5pi'JL֤<*5l>(J9f0o=~3;qEfy ( j,&bFL],kmk'1SJqyL,2p6Җ€?mL̤3(MsL-$a3o a6tw_SM5TS?jHh4c";+q| `XRւT1@c%.4YZ!$I J+;wi[oOLV 'MJJZk"C֦QV՞?scjm|Ҩg VVz] vbRy3.H Ҏpm'aDV,&V黉I@mx*IeA&]-ƲJuj\ cczP8i={t>FLB@D NwQsQAdӇ$)fB9e D4hW:F9- Z^96v p&2HcA*9Txr4M:5s1B""l})U,A$%h(ADԥ ryᄙu"g1s2PVH2`0 }Mc]#A<d-cȺ|Y &"k4 8(dj 5@B% ]WY3M8m,BGYI|&&S{6v?}##oTk5Y)P3%1$,z~NȂSJ /&:#D!5(Pab4I!fTlSSd\O%Ij)ɨ=7 -!bW)"Wș:"dI RHA0(Z BCV J$1a&ȑf-R8O1n+6GElbcSF-*{u(dn5ELmxTlk؃̫1lFT-;BŴ\X UcL i50j89Lr |B;s9f>&Ʊs8'a %o0&^]i/y!;>(|< eLw4ST65ۨ+Nf #oq.5v /e<`JMDĸA3-6_\v"cQTSM5/jw"[o3=L%#Y \iMќR+vnZq@el-LjZ/qlcΜpZjSzm!jq|n)1XցRn MM=橣gAd4j+P̠dYA2 ) bHX߇|s DΫ3ߥ" j&^3F9ER!`! '@F{s$qg2@ Jڵ)#J"a #$N* PeC> `19ā!c\TU.K&@P̙ټg;R)BTBb}߇R!̶ MTS%ifٽAE GSRͲ,0l !4=/ ^(v Ȳ,ιe ՌNA7$KyB,&X?Ax~א Pc f1 +fS~E=A qG.]43xKfsa31[zI f3GuBFs"#*BEQDË"aWDE4 ӯes 0s d ʱDGF9 /[f mr29(FӃcAFِ% yR"!$pccR, j@mӠQdjN7ȰK*!p\?֬*]$Hx50z5J I F"H3ّIJ=] τ +[U 1[+V#R1PrJ=D $I<½R&9/AA !W0 10Ԫp"IFPe&Xӑ@PʲeYOdIef*CVbՉlnێˣq`˲T]q8B@F@@PΨk (0B 0'R.@uH!t!$ B2#q93.>L!$,IB)}@\7wz##kt&M9lYh,F!CL}bBIX!B dka,T4Mپ3cY8mGΌ:CJ@ ھbYBD2Pl6%Ȑ,aY!pYS!3M*k.@PV.˙L%~>'S1=hxn&}2iaM}B"0 R@10tp* sNcaNĀ ׁ?b5vNz@bS ] r8)h/M[E](vEIMw"ϴB!H$;!`BN8GSp͢Ʀ_mgJI<T 6Gs`Ow GŒJرM{ Hw|(!'Ny8%G&r2Y-Kj$33i(\bz`p,03a>[`su1l1UOy3= CzgfoQ2Uh8D@ 13##ɀ{r@D(1F\('"yVI@TĐ%Jm?㌥nE C+@Sa* Fc+|ֳ8ټCÒ&ɜ1A\wdSR*TtvvfYXMMMIIXCb' |󼡡٣DN,244dp rB822/HE RA : uww}/ȲpBݻ?\z/0HAUTTb {r:/R S~uCPKKag庶iXjkj\8O9gFp ;2h{t]9g{/%oz>KW+>䶁x6~no~g'ZPma,BH)CO^`Z%?| $VHkoow;1177wyiag"um~W^y啷zkw_*AB&2 /+_YfM3===?O>466:S b/",ֶs{;?S{=?輅J1ҶmYlc޾m۶-[}ݥd" ~-k&,`3:p޽{_z~'OzMӄrƓ`FE,CEQDE|P "x!ءgǻru}?sMm-y㍗^ye5|B0r\T77ƦdP\DS2fsihPbh^u4GG=B&G\ԑ3gm;rLr| S3?JjEK|sn}}W_}Uxǹpi>k8t:s=---"obU] y)r_úffv`4FMNNg*]vYu񦦦/\4+Ea+LXuȑH$򁮫"(">(]E6ŝ;Z֭}}UUt_c`J5]UxmO=5::v͚v3tmVWUh 8֭d"qWWUV^lPUuͪUoIqd``;FFG ]߰~K.n0Mn<㒆GF6᷺r?Cv߾[n^HRp@~9c'NcyS tMc^vs8tŵue [LM+򁞞^7dC}CcLN2d1ߤ^cCeHBT=(XAEQs@aEFl&4*X' j 9Tfza1C&̸ӵA(>aYޭϾ4F*AB=8#1( `8}Bpv1 LHba=pڪ$ٺFIT$Q9kHm"2 Xt:}*;h ou IDATxc<p04 S6p}]e-Ex)< RFa$ԷsW*q#y;=vIKZ~LHTDںqG4:|'%3o:jE [SX&S%/ ];d80BфL Bah#TUIONb10(㈇yUUU4 ciJ ݾ\B1B$iR]S.))źڶ5Mc8qDMu% 8GaIpuL\=ӹZXPL6a-$)eI2C_CK],|vя`5MsǶm0 9"8#b]&ٵkW,kmm3@hm9뮻nxX__?w\u7mڔH$JKKũfY4w}7͛7u("( Q$(BÇK^~y^KC+7l$CEQfwY꫍ [w{6$S_{ګ S_WYO9{s``t`c>#{&ge'oQq3F6e( ycuQ¤A-c%HSN]NO}ldl6{HϙqFC&QBaKHO@a P)' t 208G"=b!# (f˚mZA-n)Kź:O wJq\RفQSg*ʢ1'kg G!%/CIBd$P;|a`KEtuM(t>!ԗM^",1E<ӡɮ\޴ #U%!5c**Kj2Nw:1WȒl#>vtlCrBcdCEʺr휄 z>'L `T%t.3)W@qrN4B? ;AHUуU|pʲ,Cc".6QJKKK庮a u+** }WE$ Dx]pO6HD fsdRU|>(i5 crrRUUQz799kYѨ8eYb1A6h&QmxẮ`ŪDqD : ?s."!b1JD% \Z8뢭^>TaSeٶi""l6+~}F"?s^t:9  b1İ+3999<GRf $bp!Һ[DEQG"aWD/D7qYii;uUW!Z 67k_%IZfÇg~W_jin޹kjzzbXC}}ܹEVW|㍳,`ƹfdx2s +p9e@hAcڸK-ղ !(Lpg L8E(c3B)e@9爱uMCL(XȒ-"cyq \ \<N#V΋B;383X[U^, tvtuԱx<.,|m*tɂ憠j*+Y0 dnֆEb ^O%K⺮d,TwGz_CTz}@n>h<;ġļʲK7MkBU3Kё1=@ M47롊kkafR`dc1K#^lNBcpL!J}A0t]?~<CF 83*eYu]P!Av</d@4M(7On:YT__/IRhiS!k"8 "ApF|0.i0Rq4P DZ,Mzφyם5u^T[I$/DjGGǃ>k׮}sW ё#Gv fH[o@̙3[ner9^SSe˖7xcΜ9---gΜ9x,wqu]'x1sDl[[ݻE9~x2;+++SO>}zxx8B|@ zSN}---۶mҲ/"^>'zjcpeeey+✷wt~t5sg뛮=[P z\kaFQ)8BO ` 0XOB>6ԟG[-+*J_ٱo:t%VdqCXAƦG7:y՗ bʜC^Y 5`e$8s(`0&vSBoK;ڻ)P>G8 dj g "8,V=|U̝2di7䱣'$@ Sg8'{zHP$ۋIsYӊKuMs VhM\6Sg3g3l42gSgOqXM#nLhKIZUY3n@ΚIQ%c?J5U?}ι9-vI OE43W~lмvBJ%0+FnF&S4H$`0iziiLB)X(W5K߱OfP.ZZZ~{wߦMN>}zzz!_iw_UU՗山<_˟y晧~K__~ӟ?^xq<S=(|u[ŋ1ƾ/X`xx7ި\~}uup>3Dѝ;w.Zȶ׾v5<MMͺu,YK/m߾+D"\__y睻kݺu{}W:Y"J}~cǎXx몫:pիWZH$!iZRR"ht.?7 0D"۷g?[n{?y6?Æ-[ A؞={6o\WW'x:gΜ+d2ׯ?{8۷o.\xmٳ/_ٹu֥Knذ.s}6e!HҮ("( "@4eYv=OXH~-za8i02RӴ}1h; =~|O|_ȋB89o>goy^8׌ M.F"?Oz gw߭(+WxmϞ󫲬@ ຮ|f_t6B<1M ht]'@MT40*!\VQjjIBL˦b$3lReCD)u=7Ο??`2VǕk/ۺv=HR$Yc aH,A ,ˎh" GCx2F|gE4u30q ~Ziڊ+,Y{իWo|UUUWVV>'}_,---//?O>yWoذ!%UV\rΜ9'Oܱcp*'F۶jjj*++kkk 蘘KbXyyeDyyy ذaCSSҥK-[tҵk'?OR\rI!Qt۶m[f5\-Z`ÇsE5,ԇ~[o]fM8ްa֭[_|E>qDUUՊ+(0 kmYYUW]ؘy䑮l6 /~FWX .޻w-TQQ9S/eY{0|,X*xD"QUUvڕ+WfYؓO>oX,;vEHn]]_PqݺuTowqe %Pܹse?\.|K/1K/ C=裏^:/]t۶mO<͛C5eYnnn;wy˗/ׯ~ UUUrcG;w!DŋB[|y!l B6EEQDE(vE;@}}ιOhpвmCBfG,[dT`ƑccDmm"G?.ܬkZAn6ٱlɒSEŒ q06>k˻w5ZZ߿tbEQ_S]]x}6^~65}f_+ 4A7Ep!1F" "{ FeuCkoygs\EAx@1>Ĝ1p8BΡZZ,Ԯ`h)UXqORNҠh%ǠM>1Cơ,2iwrtr2m罃ǻM5; B8s2.!@P4B?GAB3xA%! .-99s4jб5x2&A8xc(DzqU@$e"esXMmU4}1 n2`%@sIYd>gs=Qe4G5]Y"+0#ER@ɾW^}3ڇXP53M\APUz`DaUcTBwTC 4Z#4MAPxfYͦ&''Cf=ϋD"$|NE Y3 +g>7"dY<;2cd<&܋AUS8=ϓ$TZ,-3?},9%@ qBCY0dlxxMup,,?F"l1TY8{F[' o/[,'I#(H$ acX0]D1Qj@$ۿ[uϊ6|XL\ФG"d2 9 *ўY%:r!$  #h9G)okk{G%IyV!ru9.݉x!]E@]ST440x<۴iu]Jm[$}߿XrHEQDE| "ʍ|>[S]} 7\8xtӓ[* nXz7.[Zo8ʍڶ/^RrM77mzܺ!tGΞ}kttl$h8et`woSUU MOe I83&TN;}u:OŶ)(PB#(c(!L9gT&񡡡d,K$3F1rs&zW=7;aIIm"s .GQcqFI`8^fMUUm۫VeF$- ˲az'(D^={oz饗O!Aл7\P3MB(2#<200p.ZH"taj BhW`*a:6 C\iFA%*,]+Ah O$*~YJissUW]%lܸQ2p+n+ 񾨡`Dpj p8l낶4D"!N.8h h "N"-8HdllqD8\q?::z饗^qϝ "DD>0۶9F\ o}s K//t]3ڎ(/eawv{&SQQ[(`Ƒ˖,hT3.`ƹf%ϡ|e'D;6 v>VW&!-`$7R`p0 K @S8w=8eʉ*CDvx>s2Ɗ!=g21 +z:3#cDÑF}C#H ƣb0f@@P q6 j(RjyɎ/>CVDVKdyH><mǎ#b1u]QqD"NC$H1EA^'>jl6 R*dRƊW h8|wG Ð$Ipeee㉉Ҧ&۶0 B(RwEE}t]aB'g,a!e9N =y@ 099)Ny1Qp8,*"_8aAZ [YXJ *m"1V|G"X,1J$ *7M&&&4MJRѩVbK`b(gϞD"}nǎ?Ϸm=ַA mv|.*"("a~߿{k;rk&7N$/Y~aE@(aP(ƣ5hnΞS]QQQ vnkiRWUQGw}e^a$0rN8 S<R9Ṟ:KMr1 w|w}I'Dq}Mؔ!SSɧ|ξQYpEW))D 9P³_!PJbx~$/I%V//-sZX" 6%)$e2A`,VfgLh{8V]P+~gϑ=wu۷&N: \77:,]4L33Ϟ8 [*kp''TbxÉp, J{,ACU$K( ǒ!@ 'U'7Q)8';P2@hD'~TVV )8 b!ȁi###C}xxpld8MS# #(CCrQێ0Q9ɒa,WUzʕJ$byޛ>N)222222"(˗nذabbb˖-Bq~''&&Jm666 ^|œ'O  $v0^i`0xcǎUWi]Wu;WӟSjTj-= &^nnt_7nx4$ |GK 0 l˸dYeIT}vw{fln.p<9kϵ眛'''/^XvP)W6̣'9c̍7x=LNNFQ ЖEJdv=SO=sӿ?}?֕#z?a%]Z Xƍbp˨M CJRc%cBM6oi2wtѱF}T1ϝ\X_u1 ;WXVQsKz! cj2(f*LD{5|O?~^$*F[aCY @AI-C搄T46' \[>| %tLp f@ T(kSIKєPaRKF3Ze$F)Uq%c ]eRbPؘF=70DM]W|ѣ333_7o޼gyVI駟>rHO|O>ԅ マ}cǛg?٣GVUW_8#}ݓ8Nַ˿ ܹsNJ;GFF~~oo[ouqqӿ[uWƘq?oZOzMozM7݄rW_߹[gyfeeÏ=ؾ}/Ç%N:uӑQXOR˒4RJ-]s%ZC JYk":,3U"BnGi OZCjLxCkKZ0KQZ2kNh# rkx#f:j9nw88J '0쨎$6TJZ0ŅJ:ujjyqgY㌃*17` 3l$Ub$B&VQ b( 0k)cO5v2$;BX %jkR1a9ǏAbXLZk@ˣ w$i286Xt cQ nPʗK2<ȁ 7408488800 \Q9cl&zyWk5]OI9 熵okkJ[nܵkW6l'?yW:m۶{@\>011133cccW]u|?i:99tE0;ӖJ;SX,:Sv5000779p ;v@`T( .!'&&fgg7mڔ)YC {j333v{˖-o{vލq{,f8N'?uFQ*>񏯬޽oO>r.۹s]\ݴiH)n݊AtOtM[n- |>I??hCw^qfgg0,JGZ[?Qkw߫jDQt뭷n۶ z:)%*FFF0OO9Jh۷އ;\.w:<+"(0ey{W*r\޺u+V*5\''繮E7xcR_;7n'OVR1WbzꩧzWSO=x5^^sTgJ͛kSOqtݞ*}VMс>vNХswtLՒ2h;.J;٨7iWVǡ VJA>urju|rkדhІJѩ8H!1sqf죏Gf@֖)ьu 0Bԥ1$`FbQ(f$J3pVsAH+)pX3,cۺ8_J툓> &nEՠPS> hE/uf\닍qcJEJ F"A% iKjeBȎ6q(Ts FR/`L!ieFE*aXeA(sv;\\\N*+B1A)!Q;hjjjƍ\nlg?7wk6Pz턚sNoxa%wX 6ʁI;:;. r g$y T>KhddhbbGtߕXK 7߫']eN׭lθƘfEQX,_ZZ"yl'"ݼyjاw؁ sk.̂O<(xwnºim۶ , ޽c+@&&''뺎 cJiwuWѐRV*AX zҽ}jx⃃ߺ};wb;c-[JqBHݻwrm˻w޳gfjzwe wjo0 j$IBkm4 "c 7[*|p][oEvllLM9{ a[ʯwj87n[q{7onZBB`m4X+͍aj-r۾[oK;PUW]t y6{]w!dbL(  SO=T]O=ӏ^t5==1fIv"Bsj5zs}a1ye.s FnkS?[oSWf5sss7]sVSkꍥݻ6n8괓$YXXX\\/zn(&eX8}sǞ *a\jK22К,XXj9;s'ËKq3֥aY®:J1 k]*2&k`H"DBTcl78OMITSM* \txd CM*8$MhdIhBK,\ 6\^wh9m*ʥ1Z J">ÏhF}\?DQnPZHvTC9~i"Wšh}ІcgL#:h{26ZŔFN%ɺCP{&FQVr7J%c i Zع'}!KV!aPVە"“"bbdP( ,}L9` ޤ;<pdd^ዡT*x, > "f&bbGA QT(@` 4b`JiP4akyI ,>> _Bsγqk ynYkqȮzꩧzzꩧzBϿ!kEZ+ZJ)!liixr|GKA_E)ݸq'^ڷoM^Y ؑ(v\=8Կm6FJ:%T.u8.U+㵪?1>,e:7W_*YBZ2{q~l2V僼 h!\$QA;,pSH;3OOyRkK558ghB%bk56 ,{p'GP Xc5#4J3!,D-ӞkR#RP'QnuZ4T*J۬ZZ`qjH8A;\MޣRu IDATBI}aETqHr9*.4Z9!JD[m)Dò"5Ac@XMjm8BsZe.K$W&3Be%.a,jEf`sb1ºSZ,rByAyJuLt qHC>>5N83VY'Д:L5Kk'XpJq U$RY ]׉3C6h s> 06 F*bZk W u2r9п(4f;BLlϝm,.%h3V.'H4KaVKP-Vg˙`@ 7Pk5 [B+Ϸ"u+4N=?׺ʜM!zx|!š3Ȳeōe'a)<1Cdxn&,k-FB(mZ ; Z2v}00%<&I2Y7tfn2A֞a<zjc-Oka01JCt됙6#;dxrbp8, -B01Ly{]{Yb/l bܺ_D835$A(ɐ__=SO=}z j_9߱mo,govYO=!R:[^t`ҵDcLա͍F᪌jf+J$tϸ^ =2W'|*u.ܺƷN|CO:;&7F'NzfCO<wdr2̴[yޙsg)W\q%\8AJ%Z@)h'/:n/ /0ٺaD~%R:gkwy +n;>N-RmʂKIBic)Q38hXJ9!kiHei%,!* F# !,%3[V%P!Ѧe;VrR,..J¤:3e\~Y[j2cT5J\QiveCF{a(t?khX Ι->c'\D_[tz2P,21ԈGr Fk2@+QFV{:IWZJ5!PPJ'aCB1* ڵAeB!$uh@4QRS%! JلQb2Z8̄aZc0P iH!-U YϹ^r9/ֿ&q(H !8BPJ{q:%:mFK|O>PE*Im!լsY(,8jBB8*I,m-k@'VJk!%dJl2͏6,{e3@I!AƔo`=1.c.8Fh%uမ-C?8&fS}, \ ͆2 Y;Ű{3kXp2:],8+:KxBd BllK\YXRdUXTeq2M,3ZkEA=?seIO{o#02OOq}7mz{.Qt?Ź~{6x;};M7_|_O}w߽}۶%?^"4fR\k5eq2ysXVʪz;bR?sv՛6m\Gɓ'&VёOpnvZ[vLl<{pͥZ_nc.\'ϸ%9דFsyh5OawulPՊzvr|6_#lIj_YtGڶT3Jvi"ZDA9#9<\!ys敮AUVufw8vP˗\95eK+VmpsIZ7e\7O:%QZyeY1!q꺴0!R`RVrn-bT WWZJ3R.7FJ5¿XW4+S lי1F%Q .( C.ʴ5Vqt:H!+J}h12B_XAZk-!Rj-`yJZ# ЖRn-Q9w)!(k-a\kKǑ&ɖѵ.R*b40tŽ:LB ֒ gZ !ZJD+ !x RJ)kWc %w~BqjnH[B 3Cۡ ?G_˺d+;:Zcb0<(b #K]Fd_d+Lm E]FtЈ%</ B!N5+ѮːP_Ƌ["FrӚ92`{\2Y@ eD4 \,\xf ̊ef |e_gd4CYNww𻯢AzꩧS-~##Z?}_;{x_ԧ󅅅__:s澯~!wOz1Ǒ#}CW VNFQ$\ Qՠ6Ə/v_uՆMVV[TBY }ynޓДr`\bb (!MMGDNSȵ&Jy9;5:\Km!pA1F&V}Y:A3Cݻdu$8]jԃU0b>TBl)Z' ՑHJHJ a$AkץQj3>i) \[uR59BИ(PsyߍҜpK!aRBNĎ[ONM8-^ O5:$d2SC)@Ѻ,c!sY !4QױB1IF=K)a`)6Z]o` c(JasT Z LjE-9U <\irN1\0mM G)8`V0Xur] ~O%Y/;Y]veqGSO=]O=]zg}uwRc۶mvO~sr (7O=[TLLؾ=Bl߶s{"$`$MM=y|jfz].[F쾲׉Wh#7IS3G;4FG7TF^:<2 gN[{훘XZm*%_S-1vy)n5Z󅾼'Rt^IV'v2Y4QgIB[-Q[ NC(aR 0UCs1vn:r* I p$9q4Icj˘!6 ;P)bT.36ZmBhZ0Dtw VҮ'~&zQRЦ,Hէ2*c ˴v!bݩ(q\R]BU;Jv'Ҝ㬴[(BBZqb&;Z27u=, :k-m2in(YsWj9Jgr4eyf#4*&i[E4M 077W,:Y?ޫvv!sS(W_}u>K^l.Wv:Ktu2/zꩧz@;8I=|k_ώnZ/,sW$^w C2/{K_EG?{{L8i7|]2#O/Ru`ԩos5aT :>v[ovrr<9@tsqyjTpJsͷFTq$IX)W O̿RjH2ډh104h "mhFc9[Ԍ?Կch)87{ES%uLPfs@M:3{0P)#)w ȹyNh[K-Ҟ6j4!bcfcSy"Rʘϝ>2V#"(8 EV,mUFH;'l9Lx(J:*ըIB8EC\ညN82O$KI%6JTEJ"pbX7NXPk0X`th"A/Fm-hm6Z^Cu9Nt+%ak-H؉W[+ $<ϫכDppcm"S IZiJY!xh.JyzS)9w%0^;qbN'SmP.x'T 9b=!bf0#ZaK$D|Ih t٠.OcZhۏ=؟7뭵ifGGdVt5}I 2X6I\p¥|/T_;wooo_8NEWfX3]8N$ϟ*oݻwWՕӧOl6[njf#d@;xee{K7Ak-V#e]qV o~_*F>8Q\{FM)P,Yz;ԙ2Oe<_8 RSO=SO멧7Po 8]s#=g>80 IDATv]wpp'"Ǟ/e?r8I<᫏GRϿ__]O?VBH.(iD~A '>7oRF#ΣOP5 Vvxx$%0}vZ+:. +vrJO?-7uҤ&$KiZSf;.gkaKm8L+q2yբeD&ʀ¹ō#}㾰nv 6$R1y-2;;{ȑy̓:3`(2aFL1I4/| _k// 8dž`,vn T&''?306aK0ẔRAoᅧsMmmiകұԏRHHaX\1أ9zu:*^)μFW q\-sw[yBjBRg1T)544@F# QE3i_8y*S +s |n///5\KGg/NݻgݱuK/(qgJm;Z߷l ( iF9='B0k%fe<7 D9pg>; !z׻\ƜMS~Y֌y!A~] Bnߓ6MS1#BlmtpNk pnx51K$-M5B(rod")t!!xg7`a@$1krС-[Ngǎۿ}?я^yIq,( aμ"4Jׇu B$x8۬!0\YV\|>AX<{lV8^,dԆ&\.j۹\nn~DuE@p)C6ȸj7V:=SO=Wvۃ|Jѻn|񱱃>q|k/\U}7~x[zWrͯ>ʝ~}_*}uۈ.hY~%zKӋ~*P:%fg/,/^J}ϔ+ujޫ}{|'2jwZY2i-s2>rh nD=\)&uQaHEzTA O=8 3Ȇq VV@.)1}RXJ9P(i[^J.wPJ g{svV}Vb>)qD+ʢcS(&R#I(& 2jL-p2jv%2bWTqDccfN$eXy1aV}?ϳN0G@E3$FLshimbޜ6i+rۚ&D[c1FTDa{~{=gM5oֳް>ﻡ$YI9I|7;Ls:e 2{u347Ie,6!/}辖fQt3l@kU}:jNPDIsd aE,E ⒎z$6FRe@EY=:iҤL&#ÒFp<_+(-\/H#Ȳy^>}ɅQ 㥰܄ 3ٞb_dP-YkƘBŴR -C0\ag<^>[r0 kllR:S,XfT8q(bJ)R!3L3Q9 8NSSUcrP(0(۩='jG(2)rXL&>4|g$r]",:Q-5t "*d"*% i|w& }fa677ecL}}}'Nw3-K\.IS(FEy4)ePPJO@KOLQXZq⃶EXD{v'Ф(A$4{[VPzPOxoo/;Nu}ߧ㶚G&IVނ~`TSM5jB{ʕ\9xSc?iz=v2֬vy׿=sЋ> 5Fkd`6ڀVL#pAQұ"1REŜs8ga\dxsr9+Fs6L0,ƺžEQa McnTs)qm9WIUA ]P8+PP+G 5jP6XyTJy6&,` @9&12e`$bɰ ya`7PHrJT1Ɇ@(99PpM0xrLR9$#C(\e$PRL DL@- k/hT/_Ww\uU{y7?쳾= |l߾}b1|>׏3l%8O~+!n GQ}M6Q#---]v٤I0$Ds#l۶-?~O}jر;w|'$ٿ&fΜ#׷`w|?̙͛f͚1cXfPx衇^{5 B 8vZ)eooyW4iR6ݵkO9BQ/}cK,yꩧΆ/Ƙ}kQ}W:o޼|͋-jllܿG.]eO<ŋ1c *//YCНw~mժUcǎ}k_/}G?ԩS~r9sKǏ lXA!TҡT*رv5cǞ}ΝҒ$ys=3s%KH)/^f:Oo߾$Ix 477O2gy:::Jv 磌joo< /ܺuk)S~E544̝;wҤIO<ի>lhD:;;nZ*<[reرc3gΜ:uj[[СCGXxƍ)kϞ=۶m;s1_|̙3)jSjRdɒe˖e2Cڵ^3Ƽ ׯZZZr;O>_ófZ`A>_pO_uU\Eucc%KF{Γ&MϜ9sƍ۽{C,XO>K,YdI}}}{{gcǎVj ;v{Yp%KZZZ,Ytu-Zꫯ:uرc̙b կر#I|>#^{-T*]|K./[ڱco6mZ>ڵkcj̙ӟo|WٳlٲѣGϞ=߼y 70k֬/]sȑ|36m-\SM5TSMj@e E431R`㈆\s`ؔ\)%9$FHHξd¯Ä_ 5Ɛ:pH-Ł':O<]˜-[c2IkSPqfΜ??V^}饗644DQ/~_|7Fs綷?ǎ;t… 1?:::^}VȢ IDAT/I)[GI(} S)I{zz~S98t믿$~)3DQ800@TW)BTyaqz(;xr 5l߾ӧOxd:ϛ^_>P___,رc8޵kUW]E )\cǎ Hf玎e˖mذooo:)^E͛w~\lh-[!xgy&Rb{Ç?BgϞ=ﷺ:( &LfTlM5TSM5 S TSM5aiJܙ42Qit1C&fDiPe1qr@$;I1b]yﻌ7R1LRɬ8bܸƆrT*KȹV t}E"gYOm>kWw]=' q8z]wwqXr71GٔF='w]")bo*i)  mРkArD$@^!q8c @^%x54ADchD֚K<l4 ˂p /crZo\)ze֣3=2]p *989"9!Đ:WN)Źi3A9Zk)Z2 ( SWHͨ}o޽{ #GjhAQ86 L(5"ʚa" @UUbXV\0DD-e$LrHDF."G0peZ@ )aPsnN&HeIb~YJE6.*JlYTUq:8Z (y8q(+Vhmmhl0*eѽ֮e*GKwWJWn3f FI)[\7ns=6mVXկ~u̘1֭۸qc{{3ƍGeI`ԨQ3fxGyRrJD\v>hnnuiT>A4]JL&S*J ,8GGRda$nH4ѢдA@,wP1\.W*,qΜ9˗/oll^fM]]2b]]%ôGAP9w8e˖S :qY U#bWW"i)+_CC@?(Zb0S(tǔ %dy>Svƌ _۱cǦMyO|bq``K.>s>񏷵{lv޼ysc[[[$@AP<6bM5TSM5j1(1g HO5c]}.)R3k5(怌}},F #Ae~.BQ1un>.$C{ 8㸁KR+Y<;LI9G5Yab12Mh.NhVҒ;Ĥ eLsDe8cdIre^ÄWxl"?"j TPkd r Ly(c"ЌЀ *Ue T5D:]2P og:^vTNSdM-U0Z$-*a4c4󏲃 4AB@ D΅1J+4`-1ZJDd;2əc8IO>, w:4`A ghC.t ɺcssH$Z2d1* ]@84 Jss2S,`1zä&Z19~&ER8PHh:9CtöJ$yG꟒("*8@S$\FDljj"]&9묳z{{8`X֤6uBm Ѻ:*<~xqS*AvW^yO7p/˿ۿk9o}s]|ĉD5$Y61P{\r3$?!0`ʑ??(ݬJ낓ˡdZs9N!aǘ0`GSĎ4F:\$P N٧*d2d!]Ev;@ LZrЗ2BBu10sieV00F'\jx)a cuTw C* ,f1 f)0D6GI8쳧N:|'h.]aÆ{lSL~KR\nnn&K P~;oÆ W^ye{{{TzƎ{Yg!zzzlRd~]v7iӦM>f"X=---r˄ g .ǻ{mmmǎۼy3.M6[n}}}>l\pQي%I7}~`kjW TSM5a րZkLL&P30 " # e\mY (uwZ,F\$I byqI$>K! {w*ĉ*& E-)uW7!r>נ 1){uHqȹϜ %GL+elQw qdPhi S$q8qPAzf H !D*+BmP"$ pT\K:*Y#jl D|K 0Eƌ( B:zZ:5`Fc1J!LÍl! 1fx R`@j` ǣ 9X}p4qt@ƀq5]ߐ7K]]]B$s/]?҄ψ(UGGǸq}$I. &<Ӈzg{ 6tvv?5kV\޴iS6lhkk~饗>~cǾ=~ :4}bHl} ͛nJn馣Gnݺsƍ&MZfMooc=oL8s>k֬k|}ߟ4iұcϟ?wܞ{ĉӦM8q/n8qȑ#WXSOutt0ƍbŊ-[L<% ݻw˖-'Nx~l6}{644lٲev۝wO|bd \t׮]kYn˖->(,]t6H\.ڵ{;ݻjժm۶Qֹ{K.9^|ſ7o^SSclݺuƍ?{_2q{dMMMzw}=̛7oΝoyΜ9/͛|g}. 60~_Ι3'~:Iu֍9rر(`&Q.Fz\.~ahiiٿUfϞ8Χ?_ɓ1G>Ǎ|`ڵMEѴiӮm۶=b?REEׯ:u3)TSM5Tөj?0)p8q1Mu\624J%pcAGhuwq:`)xrW11 y.JimWa +1Sq _D,60msܸ3ș]!j3W͸?+B/9L %qߢt .$V;yO}S;vhll3f8]tѴi), /\`Acc1&˭Y+9r$|#^{#\mjj[.\xAu͛wYgQKlW_=zhX׬Y8Έ#nŋ8pӧϘ1NJI1\piӺRcǎ]|ɓg>;w^{]2+\`A}}=讻+VP ¥M6Y\GGGP$w]wɓ_~ek9sɓ')AҊZŋkBaٗ\r-.rs9^z (G7޸jժ#Gr9 `td9r$IٳgSL&wkԩ{ZO4"ٳg۷O)6o޼ 2̪U,YB;6+bܹcǎfD?5TSM5^j-TOoś !fN )i7OMu\uY1ƤF)J^cccc}q!6 "F`DD+90J!W 53M#v4zGCTʀ!s|jՕ44D5 *-!C$rA"}E@#GHȑȘЂ_POd뙞,>;2|ٹZ3 OGM%Z ފ' 7 1c9pU1H3ZCe(` r c$ڝcTU)ȫ/cu7e԰ɩ<躡ܤ-bIf87 "c``j8Zkc4rp J=xJߧLwmmm^x!"Rµ+WRn5*j̏78cƌK,Etxt3&N|1bD{{8TVB1nܸQFEQDFBf&M?~ֺT*!dɒ *|d2gϦKnʔ)Ǐ}\&M7nlR8qرcƌ#EQҒf1aѢE .$o&Bׯ\ҸNvzJKǮ붶Z쇔Nk:b[߃xc}4TT9d M6Vinn&yܸqH,f̘ANk.y-eK ,X.kooUjGe/v](2L<(m۶CKl!bCCC]]ziG| R47Ҳh"~&AĶ6Zb?OTSM5S T[׮~ՉO?̆'KzӦ{ (md>5fTcccCSDAXAcϴ(Jf'[t*@g*s3K-Tipd6ću@hCl䪣|S˚']zSɐm !/Ր3 hI T?fW_UdKv}!)Y,Qj3 zAPWU4dxUWUf0 DfF^~ꂞ:dZ;o;$C~M/Wr/l Tfު\"J \kEIDžΣ ι3ߞt"tc,ь1v)wRr9Q-"nK|߷;<RDE$N.QBT+""f2rNaH!g˶R>>gT*צZ3i4J2Y40>ӍNCs͆"RF7D!iniZgcZR nGQ8y0 @JI,l|N;q3 11()%V"t-LAOG?+@J1>d('`TA(˴Ğux4v[<ej&jzKuĉYC1t]p7!`֮}7Ǐk|;=on}%~>SnIy]T.Y}󖖖wZdt7T_lmۊꫯ1}:t?c``+6u`k*Vq\eԈ.hhZkܤ 8Հɂ<gC'Ag}9 `dýQq>]ctz/X)"`h+PfhG1tV^ie c;$3!`eS^Wt9%0jU-h=dPb8UXZgXH%l}WJ'WzTL o9}kj$7؈1C@[:ݜfQֿCNRdbg{zE܁UC7ƈ3j*WA*ĆŀTcX2ifNQNjCDDj)QŽX^~ YnH36>Qc%wxXYk؞9EĞ:N-OmHݔaڔJ#3@Dmac PWLXZ*@ 1ݙDRHB<!TG̅J,]HQYmlzΡ\f՟k#` wl8S:GVUUB-u QR>Ϛ5yQ_TYk]#F]"r_2~:Pj[0iKENHĊEZiitZ͖ Ц´c!C9m-+ԩS )6:ruBHO~u)HQo'jwՀ]M5b'|m獍jQ޽^|1clܸL8L͘>L^ݽ{ԩ@Q-YX1{֬M|SdbqfLn\tfjo\*68FD 6Fji1G6 VXU1a'$x Vg ~12)6Ԕ!" L|'aw 3Î@ D8Ma"/U=B1e5G=6ɎW1JjH.͏2C@}M\eQDDfi]&cm0lXu3 gsUz2t;r̃ *C T 7-*-TwPtJ;Z ~/d3İ,ؗY͐y*Wt-k^(!N3DHtGԫ^, a>GD tZUNdԲ]4.,;#^I8Su)6`kC/i6p֭fO'EF @."<6 ˬwGxG̎Z4%#ys֭fW뺖b ȫKPHl\&\(5k ժu+G&5rVcbB6I퍴hI[:OTSM5{PA\vFѶ_\@T=3존Zg:;Cr}~G{ \ץ'N{7TSG0 N9XGS`0 |䮣*Y!K+KeS)`T%z:!΁iUa\00)0QDAb D6qhH1mdD:Ƹ  zJD)c{PFV CxA4 :1C8iRlcQ/,`)rpmCM 0BMgQ=4&# J{;Ec~ )plVnCR SN8T:l`9X5^TKY -PPP_=4Z'T1@DPs wGQTT *o7D1"q+4hQp(?Q˹ˌh-CX- aPY9"fKy,~6NÐ~%GcN ahHL&D`APU׎SSu@K:p'"bg1F-0NZ mr[5 4pb5՚sh-RRBxww7N:OLPB1 C|%G@]UiPu&c*{V~jj=V T[o?򱏹{y lzi:韲3OfcZ[oZ*lETtڃ[Ws0Δqc\)0* (e1 1h֔dU@DU]p> jvCUАLD* F3j"`Wy8.8;4HO)HmLB5AqZ6p\cnC *B;iR&)a Y0+x:)] M6?Qa8$Ӿmij@cZ 2B!XФo0ꪩYzG Hk FáTnQUӡXCkm!9 @](3@’1FsN.j UhRo(*-/.A$IB^w(Kl5ZkӃ*g9T$m cLuf=9*5MG&b-D2A.깵c !,#gyԟb!MHH6nICM8ciALˆӅԁ$I(N,M]k,7i_b֧f3Y#a U֊X__O9$ܦӖ HJôi扵lI b}DE h]M5TSMA5`WSMogu]wO?OVc80zhƽ'S2i}q+B4[KpG9ÞRy[2#r0HI9ʝ8cTžɘp 0 Sxs"C`Pր0UJ< 1DT $6UҀj-h,dS[Ɂ IP~:H5Q8 "C7Q(ݘMvFrƽZ I Tf3u]kŠ!~b9Uʔie!DT"UFzB^QWU֎Z%)W+-<\. ZLy$ZJ1JsU=of~iPjM-JήMQG=?[.4wM>ϤU5hvWd݅&MHNb\mR|>G\T*&_q,*X}_SM5T۪jz ur˿H)'NpeZ .ڵo<Դ*JCGT׎1}6m|>o}k W_y=V._~axWϚǥ5]!?Ҝ>ޛ[Q]yk]u{DfFE@4BP[MΫ6t'ݝ:1C'$L:J483 ʠptΩS^?V>uν&Fk=֩[k]uuUL,ALXMdeF#%l:SpC28H&U8@@D֗_nѨʶxuLZ20@#fvV]SB)nW&Y[:R Ҧ^he[SK+ODFPS-h/J3=EG"hhEB ΐ |S;ON2uc`ѯM*4¸~6 5yA{CD4y?p-RTd2iRR˘-0,ZZkAr\\.  "_TzHɶ|>/FU҉y2H<`AYMMQYF!\IXJYD$P@ )Jt eh`"eKĉҲIэ$$.J3 -#Qfò,vƮXRdY(3 ",Z,D\QФh MxHtTQ,jJyP9̥RIЪNT* TJ].4 n39AEg譎k:&5YiJ.jzFk)hll7dDlhh(b1JDqagI$DH]IJ#|n.^Z -q궕Rur6˲SO;N=;O|t5=ڞ$=J{ȪRBخg(!Dp=CZD cfcNlG`#h.ŻЮ"p W^.wR2KM*C:P"][* p}'b6IFuhL4FHK46M5΀^8#- |f͑OGJ2@2,wakԵN h.V!w;)|R?oճb9.IJw0sAP },P_"Y&טYs<{\ccoÇ<8s̱c 1](Ml2J 2?!+rEcij 4OIEQ%Z0DajA>BR2RTVD' `BD#D| $7 /!VB'b u]2NŢNHgVΝ;[[[/ILR]n``DT{9eQB dtfAxFdJLv,n%3D8N\>v؁zzzgϞ-L<͛7A{bQQ<#"4>.:x ͝;ocRw2xMt:-3 LgԮ]N=Զ6 0S-#}bH"$x#vI$D& ,Dzh<3\ p>ƶDȞ1 AU`^ Baܯu2Xs~]P3CO(1MLJe¸B5k :bMřZP^SfF,źI klHB"*jfEU:7*)C!hǰ0DEOJ +<  uUb:,.&UD3\u0i\͔E>G}u\V t |xqD?tGַq/| _$u|>/#3(L8 s=\.'dV( 3Q1YDdI%YTbWLd"b\޹s]w_K/|>o:&Y2X bk!p7$D8W^y__/^|8(W_4JV( 2DU*DAy;r/aF&+hRfR ɆZ&Ype}~V4iҍ7(U.700e˖n/͛'CeCRJEB -jll0(!t5KGɰR#OXk>6IF#w6Dt;Y2梵VjYy7t#|SzW,˲$ڗ(rLNE$."d27o,kr9]3œL1ITJEq [$0y 35Jt]w߾}reY ,6lʕ+F 'Ҿ1IV5/:5DlVd߿nH?%#\!Lc>gf uA000` `|F1`/~tZ o?O~UVIZePrA8u6d^IF' "=ZJ% 7A"D1t:o߾BnE9r}dJecY19_@CG|^y*3"jhh(RMPԡp)29r6^( BAWH4\. Y6JiaÆ ס3$"bP(l\.}fNy AgN"$H K"$xͬT.ek{;ݧt2 j\q6 5/ЂA8O#uGgYU`^u56I֩xOopmN5Fx\u=1bV0@ꀑKPRoPaT+*>D=rǎ-rHFIBؓCdv>䋟ȵv59P, e`Чē8X8ZT|DYU_DzjP*9R%Jj|xH)ڌP( 0sOO$&ˍE JJ(JaR+L`mbT* ., "L<‘%5U0{-B @y,;vLkB*rYKz{{s'ō7ɇM"$x_EH"$_ IDAT(o}#|G}^Dw A J0ZCP qT-CD b)+u"l&bj5U &:"2ׂxRd5n0=dS+$yqSwcU CBKo+&fxLL[IUb\P>;ehӉi+35ۘqwc3htڕ1V0\kޱxJlAm puN(9*CA03 _Ie T*c)mOdA 4)Zg#G֮]۷oѢEW]uU[[Rwر.hگ~Ç/[쭷z'VX|rQ6)y;sLfggg:~sܙgbŊ|>r1c̘1ȑ#_}%K,[l۶mO=Tooo:m{…guYw}ofSSӾ},XtR"Zz1^x>!-DgϞ+W⋇׿>||3Fcmذ^;3.ɓ'ٳWՎ;/^Nz衉']TzݛJ;~zw}hɒ%+pӦMW޲eKss 70ziӦ=#;w<3暗_~o>x# /ظuI&}3ijjzG׮]{˗www[n``+8ZZZ 8r~7x{\8\.3K.$ɤ鞞G}tÆ Æ }ƍƮ#jy׋/b۶m/yN;m֭۹sŋpYޱcʕ+nue?:::>}$H"$$H"$޹`h3Jee7uˎSAVN8+:N*Nѕr]VTJeW,Œ+o+nrO8q̘1<<ܼk׮g}Vb"4iҙg9bĈ#G^tEΝ>8f̘~O~?f̘|>oy}kW_}W^y~O?Jo?O/\_Uq===_sN֭[l"NG;;;O?1cd2/xٲeBAoߎO~7>ccǎ|֮]+N7o޿w޹z~W^yeCC;v 6,]g"y#wtt|^xEf̘1q 6l޼q'N4Guwoq̘1?O^|E˲v|gϞ=W\qŧ>]v}K_Z+7pg}W/Zh׮]R)"^fܳ>|%+r?֭['|{wʔ)W_UJǭzi]wuK,c.*žm۶>k׮oQmժUw_?a„oyڵ\z??Ϛ5VX!`] Dwo;}s w;v;vlWWw߽zj˲3fr-=o1*l޾iӦaÆeٱc666655M>=uI$Dx/lI$D\pk)j(+ȮYV &@FB0\T@Ab!uvۈeC"R#UU^b+~K`kaq5b]5 8zVW=kLTmp"mUVqaLqb46 S ba)LFktX+4CPsbJ1,I\kqS f2< \]"BjUzy̨Ҽ^'دcLDl BD(t*,KUTbLSA0a„>ׯ߳g3رcڵg;:: 1cm/[lԩJ:kŊgϖLb~ccc6=ztKKKCCôir܈#.첍7޽\.=ݣGm#o;qEmܸo3g2&{kL.]_n7oތ3F}С9s̝;c4)Yg>|x>5kVsssT:vyǏ_`AGG'?ɻ{ΝJmҤISLK:bo߾nϟ6m ,O_loo>|gynݺuڴilVvlvmmmBa|uO?|\>dΝ޾tү}kƍ[`eYg}޺gϞE=?5\3l0D9sƍ|T*{cǎ1… S%Tr}J1bҥK8qrW^yqӧG?Yf >.w^ذa]wݵts9ǶSΚ5_(۶TŋO:z'^{{eƏ4mڴ5kܹo߾rʱc._!ɜq۶mm8H[VRJ}9r?|_[̚5k„ ƍ ,r[oݵkW___ssRGr`/첇z_߿ȑ#&LXdI>~H"$EH"$ẁ R!Qyyp0be!"Uy(& d ! ]|4G9"Ś%fF&8BU25S<-'W7':>C~!?v5`k_rlfVB ֆif̀TGЉ| C?W]E:iUGZb,!Qkޝh\rReZ 촎.UFɧ%d"PJ)F J,ˢTZv&-uP9ޛ9. bWkkX,޽{[l=:00^T{I>f&5kXJʪF)C6mڴ'xK.y?~[ڰaCCCCOOϸqJқo~I'IqƵܹȝ$qusl6;}gRL #Z[[}w$U ؙr֖嚛E)-K.6m"r-;vxꩧ_T=z#Go׷~GZgϞ~a\Nl|d2Hbr.`6e\.'Eܴ MMMRppĈ߿}_gy뭷yݍA7_wܱbŊ%K >\Stb!Uħk񽽽wqdž ߇Ţ4TJJl6"-[EIJQ\.ҦRWDllllkk֖)'{o~s`s6m'?(؃T*)0g 1ٳ{y浵ɣ8jԨL& /ϐ#G 9/馛^z饩S>|cԩb K"$xDH5kL&"ZlٔɓǼw}Og3{9so _߉͜!w& Q# (ΤPBORY35!*BfK  a||pX|8@TX4660l0$ↆr\*^{5˲K/{+( k誸a\n?t]vl˃Q.Qy@7G)e@ |<ϓXaj2+k_k]dov6Z7778p@oH b4j(9| )͓"@ JxS Ǚ2ei?5$H"Dk'ğGn͚/oen͚aI'Zuyo3,˚u)e?SNʐ;HZ"mat6l,J)"DV T,,UR,K) ˲I~7|)%Nkm!^rn6~d*eFF XlTX6ֿjJYTʒٓNYg|#e ٶeۖet&ҶJYT3@+i6m+>6?vG45Ľ0wvXg&ړkKZm<^ 0|"|`R*7X} 5s$PJ)UTlR-,R RJT5E)UzGE﵈CySq Jּy&Ovpرk B'`$3 ?˵vwwEq,d2SL9r /`ŋ}߽{I'N,YrСM6I'7lYgJiWWرc׮]J_}gyfǏ>`o;#z+qUk{J"0)"Ȓሕ$Zr'Ο?Gy߰a̙3gΜy뭷-~G}T"ٸHN(\L^r>,w_d/˜RZZZ֬Ysц{Z_'ӟ655͘1 /<餓Ĺ__^xu] ;zΝ;]=zt>ߵk}Gt:H %V('|lnn{on}:$)(Au̪0P,**M0A)uG;v O> [nӦMe>|x߾}\* @cceY'|ٳx㍍7"bTz駳 dn?'1Ϧ>[)m۶B :D^DI$ ǎv {3~?~pĈrgTBHrAkK˻rǟ|rŲe7rˊe>vm?~C?3||Tڵ{9sg"mY<ؙg3ƞtO=?}ȝIZK&T[[#+:dfjs=1F`H4 Y*$HD7 {es Su/K81"FR(:ELJYD|"U?-չHE w*RVx)DD7-R ђ)$)KE}&j/!Z2;ˍ KVQ(T讑Sj&щZx?CQ *fD TiG gv@u0F!DP28CLV 4k9"E_>f#N erK>cǎ~>T=׭[WTƎ;o޼BiӦ~x۶m=?zgy[[[@()1}^{CuvvJi} e˖B}I&{"Ț2eʡCvڵw^xW^9Ӯ A],3>:pݻz|>~„ =ʕ+wF`'L q߾}=ثﺮ8ޖJ|>ww}7NkOٳ~饗v܉B!d?[l9rȆ lry]tEb7ͽދJ+W>CJg/'Nlmmotvv^pl̕ѐ>a>t8vG$غȷ~{ƍxB;$pcGCͫn[p=VuWwݗ|&;ZkIu)N(ۼe:Kńlhh|֐;H!h!JDfԌ`[* ` BRR^R Ap㼭)$1AYuOAN1$%DTD釱DKo֜%P2Fcpxƨbu.qK(5@*b53#X0AKU2kjY (2g.xȤf&QY8tƚ50gU3S*AK}' 4U ќt8FMZbYR\HkʪnBvG'4R!45Y 4G˲R)^EfVsRO{ ,D2*q,Y2o!RN&4;z諯Z]NZ(Ȳ+BX=KW]uUKKK6vu׽Kr9˿6mZ[[p 28E,]sϞ=lvܹs9rdRill'L*TjŊ#F0aѣ~J2uTD:u}uǎf8ɓ'#Č"ϟ}/rR6lnj>;;;yuKK˜9sFmZ-˒Tܫje?uܹwtGGG.;ӻ *9O?]|sNSSS[[[:Kvgf{39̣G čoo:$X,_ ޽{gϞ=vӧ޽{̘1tҥK3mۍ_|/u 3$8KǏ7oÇ &1ʳnmm.\.ZZZꪋ.ѣǙ0aBggٳ_Ç744̜9_MrرcgΜy饗 t:Adr|'_}[n-˅BSN>}zssoyO6Mnb>3gM7ݔN-_|ѢEe 6LT"mooZu''DI$G%;D&Oy˖^x3W\1a岩m'JDGo hDY) | 9 dPHY)eR{h4)mȬ4:EĀhs= !x (Bpg& tHd))EA4+8ND^:+оtQ!rj$pT|ڪc\&} &VO9Q\k 8 IiBР@!V|0E[qײ, }_kZ TbeIJ@kH 1`84keE>*` R5Bf!2)R 33caхA[OY3ED Xk@Z3!jD"D)QO>My Y4OHG gp|x P$)-m͑x>7Do'?D@'[y+3#t| 0/>6u'l)AuBIH6ȑ#ut:sݻwϛ7OZݳʑ1E5#!1<qw1Zx'IH)(r{CdJ) 6r-Lfĉ3f4AI$DIGH❊˖'=76~؛{n|˗tTgK7`M/{VH"?4d*dDl)B&Ѿ f!V Vdf҈@ĈJU|cֆ @YJHX7 HF9YHܐ7dQ);,Q-DPM"uӌB4M'R?'y9^5771cRH8E0'O"$H K"w*L, hŲe&Ubڵ 7o3{kx榦˗{3•kDT@R5E3&fB$JY^>bf.n#DLUT1B0!\o'DcD!h47!jJly|%'G"2  (W`QbRHQ ”X"B$VJ۩vK4"<DL-P+y=z-;0LhHQ@a??֖bmEF"PM`"JFЀvV-ZV^Frj($o ,PEb5xn) jA0k˲u|}DD4e<" uZtuYd5 H@DL3O502 5$" iJD$֨+Dd0H:?@ *+8l>2*aJ1oGA>CX#}w <"OC7ɉ4oduJ:nj[*F=)&Ly^>BՅryNӫ8hJW7YݗfdOQHjZ3w? M7Np㊑σũS^Atvv644 OIC$H"$t#vI$Ɣɓx7\3xk>!L"b$d=2!1R 2P5 A10`*"&HI۠" HiN,@ [1"r((\"Xc:_Ä fy+Ed8df5>fe8n "@TZDI1*b"iBKL  0H~xlH@e""]Œ9 %0ӓD*tFi(QۊX̱ *0 JCf;Z9#![iVw0= H+2* 0`MC@J,E ܬنt&Y[3v:n___QNЩNg lVGD" kq,Ti5h@͡lJ28s+2@iN[)˲\ٶR@LH)\&A) @ #KCD{ `)FXH䙆= ba(Z <ِxIBcu;qnȹ2鞜% p'Jz_ ],|opc-Ձº|R`[8c \zZkwr՞.dh2Pٖ|#bEVeYVvl9N`"TjĘq<7؊tԡ**\ݱx4WbVJRk Z+`@ʷـna #A۾Rr6vS>5Nޮ) @R;۞yoAH8""k041F44:}HsUD6RJJl!Cٔehȥ[[ e;vf2qLcc㰶aL>|扔C!]'ehF<+{*ў RVB7S)+M]q[X#}E /}Q4FR}¤B{C2%vb!!ƄfO Ԑ&8ǣ88xȞ *9|>/ICi!]=2-8'h.\yzCLDtReYȮRĝIH"$K?$H}QOԔmF"T<,,%5ҀI) u`!,0# /Z bD @#UB""DCEHQ1Vl +%̬Y'B`uYYoKkP1[Hʲ@mLhr@I#i,ib|Y2+;egrl-dXUoXJ%@8 i@u .5k+@l tK*fJGOl_fV42`!bfV;;rb.(L?{omWU9n4$7 $!!J-lƏWhY5Ҫ1^(հ* FZiB$!&vZk?'$XXZsg$ss~uP)а |?lЇ\. rx^F|˗z'u8N Ay}E FbrBC9yr0b )'vei+jRiH2[ndS(@$D As9b! C<8ǭv7;z##D^vt^kCuf u>Z[L<pTO|}2s.wufrwI<GWh1௘ί7B"N)$I|^ ^+j!jjY:Ve!"! Ƚ_Y#k@RJgQ]5 b` pYP. ٥ϸur% dac79`LZܚL m1~c&pMo8fͿ]Ӎl kPc5Abd&tP!YP3q@{ygμJuM?UNE#P BY8. 0QopjH^e؁;&0eȀ"Y愱13v؍;"rIDĔX@)eIN֤ܩ2R 0PE0)'w&iZ-[㤚~XrrcQfHy0)x11:!n" ؍g[2H5LEYոl4,&p}@bIs#6F\k8B-=I)nj XpI %ԚWٻpz \#68b3~ugk<~ 5ּ&nzgkGx![[Jԯ80XɅ͙5{vG tI=P*a<Ҿ.u;S ή)|VVVZ!,y*6K:&fdAW SdV IDATglТƲq*7 SntGGGx≡0 dcL{6\.' y,1&Ԣ(98. ]+ÐZSO=u!ܪU"5 +-MSA{I9zJ"rJhjvmV[m*JZANIW[̨S8uƺ ItWiJ9O%tιֿLJѫ<oXAbb+@L` cTW)0n:&"5{رRI.sY CG҅"J)fpec1nؽX PQK=_u򥎂Rv{#EDQ3ELJ{΢FrαM2CLjDH 4A,BgIl'Ihqf֓NSW MFqb멉Ԭ,)k CFzz"ܖCyתuwҢu(vXDik4);V+Cb1)Ii?g )-!ψLsցcDHc6e$d5; QI bE vw,"w:2n+#X\Iy@|Lx!4SK 2# moVP[ej*HѸ ѤLX+s4),k:PYB4M货4#5i/6)iiV)36bglՒZ"nԍ22upCLjƛGCĦ5DZ.cq&/c֬Y]vٳ>#X, ۦYWq&F'Ed]R*S.[v*)T*ιB Zk(o. e3Ov_`ATGZ|a Ig$Ri[WW0 X$F㘌V=P'H2N |7o7qeKReR)Mb( Oe[d|>p19Zw80:cquvv2sVSJEQT.]:cƌ 6q5 9eZMs:݊^PP3QHsy.V~ƐYg-9QHwe9/B/Yjxס-;bg|^w2zT WF=ALaғRzDR Z  !*$3'ꩩԳZ#kYY9v&ˤG[sc BDĦ<v5?eN q 'jT"IXL})Jx$U8uNv(=FbvKDȑ?t,˔RRI*f"p,J֭?/ aFCڷYk{{{3"AfA bX -ju P.M ڤUY=322ҲzRT*UUy,n5i$IV`dy_~K|^{q'{B va-Z%'gY خ@(x|.\VeԜERr9Q|^/7j }ڵЇ}(dHGe*VjKeMɊN\U' V[m_zqvmGE_zWxjo:{/u~O?'4>z1_jWC$y  1;` Hṵ$t= R8 c⃦C }k8%c# &GDH4ŎO)- ccc2JCCCd'+M$IdNZՆsbaYaAR=22RTAU@RR i' z><<, ohhH࠴VJ}2 hDQ$EGFF 2ep="T*I yYj*ǒڵkWrH0Q?V[mֱ.m^Y%q8w?9p{f/pmuw56,"uCB|Cp&4ʘ,`)gM3js2dӲD@}8u#6YAi th3>+F6)pqYm*OCSh4B aSUgطY su2)؆Cg-h a8(ewYGL"p$M+T"R$ÕsNI)Oa%q `]ʶN̵RUJ<=6i_cwʑY@"DB v+i2QgA#De1+Omj̐Q)I*"C``rNj&MS>WUC|yJMō4mdnȀhZ'cRT&ZfPsuciI[Lx8@b6݌=w"_vEիwԩSw A 6YfÆ A\wugyֺG?"nڴiy{u]aMo*˿/+W\q5׈kϞ=wqGV `޽ghѢ\.yΝ{xjuƍ>`V5kƍ#FIo'\q'tm&I,ZxePիWo޼c``Z_E} 6cvyޕW^y '_;̲mo{W\q[ne֭sΕW^) O,6l{KOX$y֮]c tM}}}R7|sǞ W]u 'p-<|=yO̙3gŊ۶m~pw^zi gG?lٲoʕ3fxg{ ۷ J2eʔw]ӦM۾}ի{.{o~G>"g}v۶m{<۳gϜ9s>JV Ν;ׯ_裏}ks̹˖.] /{rY/^|y àyܴiӓO>я~SO֮[n0222eʔw&M{֭[7iҤ-<>H=V[mV[G+zT ˻>+/חz v<{,vc)WN{OKwl)OiFuպ?Wl0ety?g) QgW3JAsaQmJzkFP %ְ?0 xHBgsbg %.#W"!0J) 0q9(¨gGJvf5JؖENR#RD4Rxfਔ7<cdǀ9N$0(O+cLꈹ殔ZkMbXQ)4 CDRY%6]x"Y מZ-"$̀AjZ9ΠZKwqٳG)588=E]'4]ti/3wtt̞=9'Ѯ s:t{챋.//7l| JuY ._|W\K.)S>Oڵ-oy+K/ BiӦ|gggX<@|+W|'gϞ?=JٳgJs.Xo[,YO| .X~g?Z6}?sgy&I[ޭ\Rb1ľww>s}{?яΞ={Ν,R;cƌ37t[o,Yvo}[Dlٲrx۶mӦM{gv!n`V[m֯PaݎY^ISCM?D!dw ݸiuzꩥRiɒ%qz>mڴٳgϞ=N[l '{Ƙ'xbڵggΜYVJ7ty˖-}zg^xoߺu>SO=?|9S{EĚ'dV#/7o1sݹsgRItAviZŋae˖wq'xwuww\rܹR,~[Ӷjt$_<;">к#|'~'iry Ϙ}icWݥJx}dMp?`+Ϝ;)Vto{^:uTIC4|ITT5Z+`ݼyy3f̐ɓ'[n׮]'|rEI|>xOJOoݺUujry^+TA8|_yk_T)SH33<?A/X,/۷oذSNV'tR,K+RbŊ[nMdʔ)wޖ-[vqOOό3Ѿ>DYfj^zI-ZyW򕁁ŋJ% yaq>W^y_~guV.+aInDF86nHDbT$ɓ'lڴ饗^Z`|"#,}i,ݻkYzuWW򺺺$<*xW\>Gȶj~viC:|cO[mj';}i߲ަɶw 7_i6ۜO0pb; muL]8 DL,̎QI` I`kW ""\y `eK#T!0©RA:t06TT A`Zk;ٙUay,DY!t-"J`|?_>0\bԩS7lؐ5|K_Z~}.9sJ};묳?~СN8a]wݣ>ŋ'MTד$pUn訌Jlr*,̍B i*Ѯ_~̙3o_֭>pE#!'ZG8\}e#brY\{P+mlllҥ]vYOOOW\qEESLJpR HiV[mk:V["k?=xåMݵw;pŒq%:-v߹u%qFFM:X4QT2QC-!C Py501aHڒ_2B A3 4 9q Mitudb&t)9`gs>(`u)f(E[eY#d 3K)flZ:6A ٩Jc @MzPcdn8 1hWձ&]&njBF`<nnUb0J&Dr'G4ޗNP1R# :fpY6"X\y248QRTzPE9$9/CKD$Iq-s m|^sNEiӜs۶m;묳$U\]ӧO .XMoooGGGYďVQ|[-$3o޼~Zm%>uttTp:SZ駟.]wW_~ۿݺu˗yPJT*O>ovXjI0RjӦMg_~}}}\_u0m\Hm1i۷o޼y2Gj^1cg,˲e˖͟?SN뮻J>9ĹVקO~'?YrU;yY3|[ a߿1Θ1C pxxOhΝFX,*4}^۷oppp__z饛oy͚5oO9B W.H_|qllLpT>}yBZŶDZsN\.EsnҤI===Z뾾,d5:o"ay V[m~ؓoPj[_ʏ/JWӣmaa`՜KCqpǖyyS7>9|~rJ_c'1_j!9A!)Tw %g`=V՞Uh|TJJ~t̐3j"D&҂P^+-;ڊ㸞C#l3 P; ?{U;{UDZc"%\<5";"<:Rc2;RQ.?tؐæiw)l޼{ZO7e򌩣ŠFƬR>r:PҸWG+R#jV}vK鼹'vZcNu2d=lmlHjhhC Bn2;,gRAǘY pCFuCaz-c}34}cccc ¬YVXs=#cccwyZ FFFn{Ozʕݧzٳg+z{[dIѸSO=uٲe^{w~}}}7Yb=SOM2%˗Ϛ5K/=pڵk{ 'ڰawC[0u)̘1O?}e-^믿mɛ6mZhџy!ŭfGG}~ܹCCC+V?5ku][tӷlrvvvp 'tidɒ|>/V:D\pxguO~;gܹR/{u5o}[,Xp˿,[ yXj=ܳ|ɓ'3… /Yfutt{`2yְ397MBBL Eh-JmǷ=V})Ԓ֖֮VlԦq@!@  θ5<ޓ*}g^{]}ű:1^f͹rnذN;S{{{+>}pfjz 7\rǎ˗Mo)˟'}c;3-Zd뮻6mڔ$z߿cǎ7Wv8Gڴi??w}W]uyg?g?SN9塇Z~>W0l6=#{#E_ȿEZ+싿?mA긢-xtBa elllfjB0*s6(J@4T"xUkf2R0K'TY-бRE$ Ƙ0`<kYEhB創DHx5pPq 5@FT٢B*3Ȍ"Z@Dr`D %%cs 9"Gs(p9lӶ(˪BD!%5 yAJb_FS'*cp "3 …GrlaFh:1ݠc v&4X|kq,Pϒ UOQHc a$eq+HBN$ jjMVf ,^0PLu 糮7QMTS|:3Y'ΌQi+H(#)=ւʂ5dF+e2BFC眃Ux ́;͙|şԧyj:88xi ܹ˰EG?  bҥ/=|pTЇ>e``X,J=~.tk]~޽{֫VZf+cr7^r%z=˲O?}DlٲnO\.^veywyk]%|w766?<<W\pI)իW/^8c`1 CZ_qk׮%QOz۶mryݺu^z飏>j-.xozӛ.Bgk-\3?ꩧ^~\pE K)}$Xl'> rvɒ%}{b>uCp›nNsۼyM7ݴh"9388O?00pWr).K.K$q71I8D _,]tժUiJZ611ee]:?a$y|fjjjdddѢEwV:tc+ذa|eRWʕJUV}#QJU*[lT*ZÚyoo/>s/^Z)BꪫX'8ZUW]uիLej'!" -Ia +KC>(n|QQ|?D[/« MEQ7U23$G /3nuMh8rrc)*XhL*SłE ) [oy p9 b{)'r ,PJVφSuKdđq Q;u hI^Ƕ-,kZe-"SSSZkmҁޡVZR͵O1,/e! h@ _͞,v#kQ[v @N\rD4^oՙ`~ZY22i+FJmdfy~Yem~d!H{6K 7隢V7<l&67ĬR 0t,0`N pRx>81D6{^f:MkKDAdYV,}"=Zzk֬iGn\ҕ#po{}Iid Ba* k_ZvCWqJ%WE:V,/f)e@WBs=]ύg Fj*wRVkɒ%WvØ*:ŭVAX7y;EѕW^ubꪫz.ؽ ~{? ꪫ]J;[F2d]g#fJ3!2hI<7DF*L'RG^[#RF[҆Xܡ' !G H&tOC@)5R2{[mtʌei%٬m2k)7ATMJm kAdIe8V^fb1Id\2ry8G@DkCdDq{I"c8af3ra!+dOL[K5am4bxޙB9,=fFZ-KKa^X\^[Dh ` CB #=HD8ـS$b`92sNڀ$$cEHV͙z5E3Hha B ݓSVcgϿpfڪa_e=L1^KlCc8\+z&SP#$ՙXcr(6qx@ǃs>ׄ<֯z|دb#oh`GUto```pppӦMR]K_]Μ̅x.[ _>y6YNysͷꪫzz΢x-Kdoꪫz%uN{gR3"Xg2` pU'XaΉ!T0G :ܣ73HJ𐈐8E ,2QHrV˭y3+zےq'4֤43gcJ[sۃ4MF(-k,3+K1e(`vE#ί9+\gU {zz]HyHaVޮFzQYk詔"?p1f%[m`Dßr]9[$r2Ĺ1hS;lݹ[A VOfFdE ,U/c?yx䡙[AJpᙸ9ymLh~eHimx+0%$:+B0nc8%4("r2Z"¹~:os(ᷝuX|vymG}A>vĝmgׯ__(.]ڎ33p4PG?N^mn5ݪ]uUW]2zN`5kkW+]uUW]j3V S\> qnqر֚G&h$O<[2.R?T(իZӾWZVqmsMY@ԫrQC50eVka`CDrK*B.Q4}2l&KAĜPmrBNc"ƑIfkM92]E~ y$5yW.rySA"JN~daOGhXh;D:tM' !0@B ̀9S"sZFs-=IZ["eslYVMlR/ݻ<Ԏ'w|Y]Xaƥ^رkpfE C0 <34MB?LL&r:ͭb^Ĺόc,c$4DVFi "ksp VQ\Nk90+N%=a{;x;nW]uUW]P=nخꪫW;"Gl$2d6K^"ZH!46LkD*]b_aOk! F@kf=E4*KDE qHBe3d&r@JidgM"CB(cBr "J 0+QXD` 1"$E; D`-Z6eNQQD쀿X2w-b!c===J)###yZU^%FʉC}bRKS%$#+9;Ju-˿9n0i6 qTV#"4Ic-&ee 1L&LLLⱉڡxt&>@JSظvpYg'jU3159Q3Z#K}==RIV*,iTV3*#i-Xk+`1\ڝ<'BW֒"+q^+x M8d9?b{$ܓi==бCD.rFݱ\yV\uEmkI|^"{W]uUW]WG䮓UW]uoGixTfRkpcUFHiaeJivXkQ=e3e-'@+H=֢cv4UI)(IVO4.GYAH`3Ҝx'50abꦐ)g>al5!V:0ȬuBEsCzT+6 l'k9< LkaZ*rs qOrƝU1p2ƌ}=mNj#^kʹr}tsnv.0FlxcLe8*c &)Β!F^O z«Q +)UH5jzνKF* T=3cc4Sl$M-%iݲJQ΍[Ýh8֌vkzq1~UqqqR"0H^HjW ;p=|Z{^rLOꪫꪭ#,UW]uo1;pagl<'2@Hs:22[<fea6L|.F`ɺ00=AHbFӔVm487(\*y4Ƣ!nEQx`9YN:ȲaiUYI3/XWߣ WgLՓSS33[:z񒂈&dդ*u&<{@"gK9:b1Nd-"D  pv |\๨MgmJ5ciݼf_ZӜ$+sܧTM^B{"'yW ou΍^=]:uUW]u4 >~]yI_wꪫ~DGEt8KDd/?ѓs&`)IJq4% gjLrLx#Tuv;I0d6 Ӥ6ؔ= 0BKPj!Bp>D8NU\*RYX R!1\Mvfw}7X|8|:ҿc 9 \>織#"dcS$yjPYH8Xc0s%xq\6A*K#t|vF㚛:J)1t;Zk cԜkX d V=V,]\*{L= DN }XF =F/D[ VDԮg'Vzں!<T 23Uo |`h cr3Dd%B(8fEaW pCdB8u:NfJ>ǥT'9l'LӔ1ae)WeX=m$lgܸ;E/4{@dW]uUWgwꪫWFDD \Y2K,2P#g̢513\rTLq̳zi^ mc."1k%dx˰HSdHBìEqݤjMHk6ѳ| uтJ!$VW{15%^.-MM򴶴EozK`3Rg(cJep\\(4 p$+%ɸReĬfBYMΔ`^H rWY\1sND䌑Zdc `̢#K) Zũ01J i}iYꪎ(8?~Ol bnj$~ąE4@V"@"#cDH-0@$Q "㜷Lx%_9HcJ /mM&0`@ &F( %c/Y{֕d6 OS*JrR1ֺskÏOMVEZ3QTXo}ߓJLtX6<ȈBd&"&82Q+ |&8\Ún!3`dЙ؎:Bz2육J,˄7 g%s'曔2sƘ+y9HR 0LA2ݻwo߾=Mӳ>{Ij1xJZqYwt p< VEQBIt˖-{ܸqcRJJi !8Zkױbl6]5iY`B(vܹ}8;%KZ-cO<37 !\\]n9]<غA31'I!5Jz$I;4M0TJFQTV]cvںu+vi֭K<)|'"w!<υR<ϋT*iݧZ+r{zzFFFA0YGGG]O q57{vէ .=4::dbӁBl&HFn Ξ"_nnv ӱxr ˖-[vmE?޽{8֎lܸ1(`(L Ggс0 k&[l- еAIH)<,8}9NdͲ, JR q(Ƙrbbb޽7|sT>7449o4RJI:r4- h0u}{~uֱ1r<11z뭓w}… ۷bHD:9i3&(<4 (rA$zn(2h}wO]ҍXzX,:sNNN~|G]֑>WX,J)fE%I&ψjq!uWCG厢(I]Pa{[ne-[~gxGy'SNYr wxhZ뮻nwJ)y/!UW]uUWϥ.몫j: H &Yb!" VVjGڠ2-6&DVFjKkSn e EsF(cWVL-/~ |JI3& XL>P}J_}tIqi 5evԪu,@NIZ-I)ac c1zQQB஌,҉:p8vT~_.}Ch4? 7ܰaι51JRjP(SSS<@Xܸq /<|>aY ,rDF)sG*iyE:MJR\t;|;Z]m$$8~ixk_i  ǞcQuGm߾ߗ/_;v Нu]m۶;݌1AGAqW*R1͑/UJ:pUJ)gssh=QǑǶ1~r^ !.]vm߾o'vZ$IXt]A!cdu {$g1&cGQΠu]\rm۶9&뜕P,O6m9w~81ƸQu^]uUW] v]uUW^ya^^#lb3Ŭ 1,.VH пށ&5U6c4v&aڢ\zxV5Y4-XBc! !E\ gm(e0D 23̀$Y IDATxfoec\kmT }?RDB8t58ΦCm~;;n`b&I*JfU+k)>̞ɬq4 #IXRq,yYeؐ 1hUn%Kx$шm۶hU[$HvMia_ei+ZgK\.;OgIr\eCR$G#L2T*6fc*Z-NYjC]kP0bTrlFy|v]'d?/ +n(*RJk}8p`ݺu6lpNOl;bX,[.4]++uUW]uQv\ds/+W{_9=??9磌z,t~UI<2\ sùw#i}8@:k4$IxaE̒4Vh .-& EKA *F8cr@M90 2ۜ^Wfzד>&޸Qĭf(` bl`:HH㎌92`a;uN<eR:tPDžBahhX, CT F^-A \TY6p8*$kffjMkmAk9IҺE@yΈVT0vA!di\ =]{Sׯ%`΄r c,ILX %XX@~x&R<`hk5VJjmjBIt3Si@L3RC}}{n -LR-[! CFDZιS.3rȟk p sp<$IӴ1ٻ`n>jRT. j[tјpѫ<ϕRVkŊQ)4-SSSqqy666DZ3yV.uIdzzeshppPJp^-ˎZbs# ð^04nݻw7Ms!Je߾}v744EQe13LMM5Jۣ(tD9.ԔR\.; ^{uBˋgiCic̢E\j XZh_驩)"ZhcjQPV333 H)FquTrRZOrZjRrl֮'B۷J(".Z=ڄݣcvUW]uկy?y9>7^z%tUW]W-vI,V퉓Pri,WO'ь!1K$Yy^U*&DH@`k%Yg&@`II Itl])"Ȍe$%Y ='jOH~d(,L%SY>cBM8TsˬefU0Z=t9RZ ˗7CYT9(EoosTb!ByZV$)Uz 2c̥VZx[lɣb] @ GD7c.h %qĎC Ƌd3όl8i$y``BϓXK @4e4ʁ}!t,CDˤ9ZιL0 "wV̮} }qj獦Tx! [|RÓ3ql F+V,:>ַuƍ*I)|;sbbG8㌫Yǿw}{}wP(J۷vm!l6W\yW!n;sӦM__>f͚??R_y?mOi/}mo{ے%K\q 9==}juttBqwyy~[G?ѓO>c>q.o?xֺh ^uUb??~ \vew}__]EiZ*~>C|_gQ(?I<'&&֬Ys7J)Yڱco\l q<̭OdY׽]zO~uVVZ9mjJ;M6?җeٻ?{ַ|~/ڵk9x?ywuMOO;y'[oݼy3'?>w}wX馛AE]7pȯ몫U{Ѹ~K.?l:?gTW۶ ^CtUW]qqRIc`MÓEܜf5fP6w&jLMR1l.4rnU5F[Bnڀ%͠`{<מRXΙE8#9y~H[Dc5 RR fdfdK{M~7mfkǾZ=/N?mCgHj  8cGk޹wn?.3+y٦'(1bX*0Gs#(ri8!\H$yAIVHӹNZL-MZriZ<"c#\b)k-v$${dڣ1;h-igN"rtf@'&ᜳ [|;wY &:Oc0Z ^b*S< "Hq!BTHa$b s Xb_e9l6۷jժ .g?gϞ n/?> _¿Yg5==}=4%Ks9W;~n8~+b3=cccW_}{~ _صk׺u.%K^ꫯ+{{{&aBr-W^o~8͛7/\w~wꡡ!sk6>5\Guv>u~7g$#CCC;w__W8gϞkȁ4u[o v[vy׾;j,xҷgk6_~? ~ӟW۳gh=ٲe>fuO~>pW?w[_,Zxgzzz6mt){IMoZfMX>pe~_|V.ŋַ{V+WܼysѸ;ev{pzꪫ^z~>tү+õZyR\ᗯꪫW^$wc3Q5mI}ɽ4obK{^%)3ȘԚcʝOT5 Dfd,(GQ.3l`9G65#S&a `s"ҀB bK)B.l+y\ (s3<$[FfVÄ v^.6rO80X^GzJ KZ}|PNg@x2<qm71( %:Jlт$Z |'|o4 C` т2 "ss"ܘ/b!NF3!)rEz+W뮻mve˖-[WݰaCI+c=//rʞ .ଳOz%\uUÅBwtt9\N:W^s5˗/_v\OoY~R3,<آE-[633sUW-\K/]Qv]{rk3*hH,7`c"JHk%! 6-|>BHLBOIv88tMq,˒%-gF6֛[=gs޿Mfff[xWy3<<|щ #}_<11\WC .`۶mmڴk߾}ZkͦRj֭7ofݻw3ٱcûMozSE8::z7ɟIRy ^pyŕ+WA066VV6n%z{{GGG IBaNCBlܸ ʕ+-[V,WZu=pu~8,XuVf?K:蠃N3FxwG>%K;sO~u^wn$I{{rswu@΁yZQM< .N3Dts)ʐ|?QYC-餆0AH:tVJDQ" "IPaRk5d@JK$!GIJ  B#p" J!@ e͜4ϢBM`"Q:-8 A)kpv!5FtR!! )JK.|jA,+˖2O=r4 -[zv2nUS,4Y>Gi\ʹ(IŢq:" d B(8_v"H)BSA)  j85j~K~߲SOz^nڔ O 'tf [mՋh+~IPUMrQٔ"]66#T V_y?m (gKiTMLV'f)i3aYjAE@V]htЅA B33֤VoQ3RٞzVrH|b R I:'JAH b~ @3H"_#jneBkg< oxOB|Y${왘~o>cի9y=B'g_2 lls{m4VbիWڵklllݺuȶ A$Yg}njjR߿ڵz`+q,R8ٚZG7 6HM)zݷo]&3q85-޿ۿS5qr .Z-<==}}޽G".ӟ^./|W\l [򖩩[oСCf3l"AzWT6oc=#vb6"Ѳe^=zo~p5kЂM p)܇Ω5CVJ)m,{ɥq Pk$BJ 4Fr$ p$!"EprDе!_h b[8 mx.(gcȈ)WXJ)LB  k˺W@OB8JglNzi4RB:Q*lْ-l>U|˩ZAD8߼ax 릧ub"bQ1.!l\>?|gg ' "+L0>]܇j58}'|ejʔYJkll,˲hشiʟ&ˤFZ˶9S]qzPi&ew\%c`^}WטƵf7ZiX4 l6\4ɲĸHymEcdO%&wx:nݺ=ٳ>K.+ܺu+IY"6(Xn%5ǃ ظqp[lYlygnM6/e*0I,ۀ vɛs5$RS՗gd{\V6zl6Y Vl&Iݽe˖~?0l47tӏcYFqjS˙~~kppk_Ç۽{y睷iӦnPw޽~&VƗgn11}<\Bl6ٳ5IH 0䤔rnnn۸q j-8xDST4akUW]uС[ox?яկNOO;;|"A}Jr裏fZ~zzzo~ R*"[ցrRٹs$w [%lλw8(:|=oڵ^zRꓟdVk4fS=:99[,Çs`!ݻwo>jfYA)^[Z@m?ktA̛6 իoO8s+Fzzz ˇ g>7񭑑\TRZq0;;{FAt𫌓";8QۖKۗ.4j%d,ni%.#G?0{c׾/ы^444iuO~_e˖5Y~wܱs΃tM}}}W^ye̪[ko{Yx㍯zիϞ=+k_Zu+>/zы>l.Ӗ?[nݺuW[n߾??o喍7j/!_/]Z2iӦÏ>ڵk/;+_ʾ>&dyH):< G]t5\{[n5yhVKV\?}Ot}m޼޽{ 7p5l߾[o׿@VR~_ݰa_}kݾ};;r=S.={LOO_}ӦMYg}R]J/~ѣ߽+svmۖ,Ym_z;蠃: q/y=Oԧ֭>9zw;=7y\^W] /x×ᚫ_QνuKtA'"PN "<gw2^xDHҸY1~}^8W޻{v5S+QD=۶l&'WV^)VXycyt=&fOךW09䖦'O8.DID TSg@^1[sfMzClA@Ukƭm%o)t)>V~#gn[JD,K;`Гv[N|Ӧ'0c\j{/4m6s d J@f !dZ@!9!A9H$M63 a27Qyl>]ȓQ?>W}`}{L*+D+mlXdӃ@ !}ODM39)Edfl+/BEz$3 ur gq#vYg_/fƍ??uѸ+W^_.GGG}..ƉCCC^{;+W, x+~RJ0 _NTb;/|ddȑ#qرcttg۷odddҥW\qÇGGG?я._|%~.:s>NLL j7mw3J+G"׭[i\,˲.{|||bb⪫-ƘJW}BPhZιuֽoBpqOO>"*A7 kݺb{V Hi'9GD@$x#gxU̒g/N`IcMgc 3ꊜ0Bn83J%@KIو[, `SPRx,wx2tjv U.oa䜋[&wW}XWE8=-̜ X*SFz-he1:DEevHt=e]ww>.XfzdMG6MIlU|0B)ᜳdIi N.Q%@4ZIBPk4 I,45%%PLk*OE8'dg!'xjb.jaTb&+q6췰lٲ5/Ɵ(bfp8 OfTfxbgRiTS/`֌ 0 Xbffo߾}Ӟ4?eZV\a^gYo.B*3!DEG{;+cr}+-TGX,fYh4 5 x#`*73VJ̾x6r˴~D+i5x].W,e&)K`bw$"c' 2 O 8n~uL4$I}〳c/qTww7OKnih޽OӞ4l+(cW:蠃:8v:蠃_mY!$[ I@VHKRPD$"!ZHB d @I!2 ƜoJ @$@4tCQw cGC61@9 JK7qpsPPzggg70~lYTb%=Ӫ}4Ӆ1ΤiY<K+rĦlApΑهH 8f1OҒ.HZs+ 6ީ+@VcZgZKC2_ -N0@t`@k V -k[4( AV.Dda _ra8P!.Po3J(ID“Z[k#HMHc8JxK¤՜ !gf 3VR+BrQJ1KlL`TU!yMGR֮ظ?X9rh(>:C{oxʸ ifU 6sΥB%%hEƯ!=E9EI^-S*QOLl% Bp( g:$@ o٢?=N#>}Js-3,"1-$})LdY m3kbTc(e9jc\6b;*SBYyiӦ>C=tA_׍rI070 L@}`\|5r߃G淀9{ran4ywy1PƢ$/ mHAB֪wѼ 9tCt ~+g45@j/:aQ ?K 26DD댱@i (Pұ"%!h;al\`gGQCDt 8K֒Fb, O*EF"v"p 2DR%9g<-dS}:蠃:eq")\tAV81}-?4Ny\lV{xsJ2żJlءb+O.Y~BwwX$7-)"J{M8z$KZ(}T%AqB1e'gߎ [X0x}JLq1_(ce1V Q.FKbRpzbHkI֔~r-E?H1JR^?׬5 2GlB=Ü©RbO(@D9BDa[Q#ff8HJ4ƀDiZj9-y^Y$WuQ$@qŊ]%ׁWj4(zƧflZBKɩRhTAaQ!T[V3th$q3I*?X:Ly1UƏ$5BybY$ @$!oC" klq ?)ٗe*K8$\>'t.%W̻ Ou IDAT s֚eq, LB4 .Qqh-˥rS2 |D;S8)Ppj8O8¼"(,EČ02:$;/s 9&+* HM9VT u :]7$"J)I\Io'#"Zrs"Dp8PJŪLkK-2 I&@yRaAB"G%I@ICAt:]tAǡC$cO^,_w\ͧ2&ԙ,Bj PJ$0z˕,II\ uzFNi(7]srmatgwۉ ,0(,|i<,+\\D(uI&,e-L X* kP=DJ8=35=1nlZ-, ɐi%R $I$yOH}hFzM|9dN0Oଧ`w8>piT^U7i%B0,DQ@P+4`%rHOpgIwW=ᢨVZFF L!<!D+_?2=8I]实(cB։Z5 <[m:pȬK$Y') 2" 8^=x,mTxZbpic(lr>)rvg,X ҈ߔRgYf3Nx,aYB:'J 9% nfZI@jo>dQa^Ţ,cv': |O*8P+$EDϓK㛒$-gY9y\7Je ( 6 Hk15g6@@T'4 `G!#"j-WAt7®:蠃c8;V6} Ӧx @;x_lVi@PYJ)5 Zh d QAԿ`o|feJz6,~F 3le-P+3Z9Cs؄A.X(H!:cRSf-P$%%RT.q-bx*Ϝia~BQvil--|2X$˻ս A(+`5 8, ݵ2*űҞ== )Y"%`YJ)t$ 7ĸ=%@ @$oBf1kFK$%HPBy|DY}-fSX۰xw2taTN` S|F{'+֭i֫drǪU.J4 AҬ=zfCuMZ=3ΒrU̦)w8HAØ!+ ~}ZV,FXBp,gt2G 늈l4_.| ÐXְʅH,k/y˖`rSv\خ6z #@BTB[őC>&m ɧvR$p' GnQ8Z "r@H ݇sT"PJZgȦ)P `YglP,I)$(h"" JB%'ZБ!$ߢRlI3頃:®~Vx矕RyU}}gٷSTo^TO<46Çڴ.?O?=_?N/Nx30vD9 5S5@ 6&Ƥ6Pp9[Ͽb!$EB! 9O 2V Ι$S&K2@2y9E6}S_ɹvf H6ɮ ]Dd-@HI@iUlhڲ APTYf%BSٹԑaWB-)}H\F}3T<k"g({TZ+* +/oL-SJ`%i:3ι ,Hs5qvL8WY%R" C ,4z}}}{5xkc ``oWjM%(Ůr%RWPb R^VۥLMNIBHRZ qZ@iv}ֱ}vޭڶm0d]Ɯ"j4M eiFQj`AY֮;SdjzQ(?N88ȉ(0 ~>{Æ a6 AIcA+%!C"9!D = HЋ''cr )o @@2!6˚DPhfSG{tl7l)8B'$A|Qݢ >@d4j1K:蠃~!:g &n/u/|sիV[ ƶmg{'bjj?#_hO>BD!+шq$D(DA-9|yEiMu`!ƒ,]_偲.3&$̑uu , ƒVwh4 *EL3Ηq3ȗ׻-XjmP{GWRJuh?;w~޼y3KZhHYD{(2((GI:TR$bOAʉ꺶*B`AeLRPA4$I]f*ᮬ;6 +pTERsmU,F|o/S"!$RB}T`Td' &#D (#3j#"+Vks!r@B56^Hv66N "xo~OrQ_W={y!4uyl6gx޼W;biZu?gV.{sD"1e$M6$I^rIC}yZ]y[x#L.Z<#"ck^y c\YQxѢh4zVߖ[/=_z͛)˶YUUW.]*Q~r=,XWK.e矷lʥKE'?+.}~⫮4 hoo_K==ϙ={Qb2bCn]|Y4\0N83>{رꪪ+/\S?x}͵\:o?|yEyycO>ohvK/78 '^H{4ؙm53*--d7|$c ) 8(`g#蕍2BfO3c!R!FScd8 |߃ TY 1t]'p ԏ(t:-5۶ `uwwGQƘ뺆aXD< eYp8 ~8#y `'{vznxQVQh2 .ۿ@Q8 (#0D8\7e,fF(-7YQT*#Q`I"r N{fpigsl]8xJKJ`۶ox޼_mW_{ ^YĉysvwwǏ{W[ή.q 6^,Nf[_| G֌+nꦕhijбu,ReiᘑUN{eIHH(o-ez.%Xac9u bڒHD MSEQ4U7Xa,$-1C"CbA0q}>dcSB]Sq1@W`DP G_i80ł"Rpᰦie 'x@4 ^4M1 u hll'xι8A8|]w}AB!1m!#4MЈ"0 я("PY ZM,vp>Ac(RE6?Fp]We]=u]u0 PM᫲,iEAOrj fPӴL&su]UUe]tE?eJJJ*IR(D O|!ᜫ2Qe`Ueg =E [s'm<0u*aksνf]Q x> KT]1$ b:S`$dʪ.) ;YCUN' Y8I{i]B5]<)(D OQ$ Ta.aHjXUշ޻c*aCW$eSΌpqe5d(aC6dd"$)"N0kƽ S.f@|F±h^!&VMs!r_Oifl]4sr@ ftBxϿs3:[Zl۾Zv+̚1CЋ͚1C4Ho5}T*J6+&NnOg<C !$u3T?q҄ 479}$I#FlE85rիϳ]f̐$UN;K,kn~yKpƏjwF143ȏ*S誼$TJ4I'AO{̤bF!JF>Q"\U(ÔE `3B,cU80EW $a9>,9)oGBsqXh0ƽA Ds㊊X,yމ'|<ѣ*x.;gϞ=gΜW|Syo{xqĻtLq]rPEڭ-p}vV96X8A}~]pag)DPh81m[L^Q˶+(W n("8e,;{zDB@DDvʲ|'US]jjJiWwKm'N\yHEԿ =bE\ϝ줤DId=S SL$r;ޟq1 1eHVe4MDDzc:A63jX pxl?t}aiPzY0>mnbFCup#˜ ऽ)Bc.fpҍe`cD TƑ_ʄ('r60F(\k:!(TB  bIrE@+(2#  AjOPೞ~ z;0 hc|7 T&K  ^oX,tdv3gNaaƍ3̙3p8aÆիW{OzӦMw=nܸ;vXBPKSNK;;;x≍7^y^{]VXk׮ |_4-N_~ӦMyyyPhdRI|:an/F=C6mjjjUUUZ駟>}믿׷lٲ+V1[n߽{?`YV<,XpG}wYhѕW^yȑ|׮]˗/eY^zo]PPpd2y_q\yr^{jϞ=]]]#FغuM>.[7Ǎ7zG}2 u]hcˈ#hAEut[{wnwR_\.i;eV4u1KOyŒ‹.a)V_b7k+;3w|g뫯$)K;vKWd^ZuܽgnpsTԗ\Soo^:jdYm{HyԼo)kx^Tfk_xjюh$. ^pqիnݺ1|w{pѬi"$N8`Co>t蝊HT\T֎eeely .;)1qT "ɪD"a,S*s&;/bo,#빩T6${өpcV\湴C;z aKȼ\ l@$U #Ʊ `,q< }l1Ԉ A?':F+:cQH eKP1/*m]]:y=m{7A=/?46ԖBa4WV/ӟa$mC2%ES͍-er3gy]M~]UްQM#+5WVV"rx*iIJ22̓P@0cc]вX]eqUq,IY3A\ckD."FUK W򺺺{n߾}„ ?яFTeԩuݻk߾}mmmwqGoo7o|엿 /P[[|m۶a'L|jYD"_},}_ĖkOTotDѣy!4iRggO> ˗/+W^}]w%[ouܹw֭[ {ĉz7j(Bȶm1P(/|ᦛn OoTUU͘1c˖-{eyرƍ۷oѣGEٽ{s='e˖)Tu '<%KoߎZxYjkkۇ1onn>t /WQQ'މ?i1x@W&ΘqD)E( ,WVU Mpzt30oIwD77V*?/VZ\_۴6L7|g}Ѩ7V?󻥋|ӟ6u8 +)YW_}0+yѴ_{Eԗ“7v.޹sսV_I . B$ aBJc]deKn +:+}Kƍo9Gxm+yu'ڏٻKөDfO{!ro;|~eww+/ϷwtG9k7]?l6 oY3ʾv½Gg91q„·v[G;who==ޫ0M= bI7n!P$$C D<2)u͍e%1/}O?gϞQFE" r-<ŋx]v-[\뮻sذa᱊466R)P"xB7  ]z饥!A*`E7a$ISs0rȋ/x̘1K.5 #//o…MMMW\qEEEő#GdQQQkkaÚMvuׅ￿_޲e˥^*!eӦMMMM---ͻ[z衹s綶VUUqE+ 7ܠj$g?#0F(^WWUUwvv;v=1믟2e pE0Bm &X,fQE:BHuuuIIIKK˵^{w?f"P!('j2*$cI!qʪp8,+j}HF}ߧި13LNdSi't9{h;H}; O4uɵM*Ų41ĉ޾TSvy7s쫮:dF\?pO7ÁV*JJjGL>|:ۏ'6yn¨g_PͰ1-ڶuÞ[*k̋WUUl @,Ϙ}ةGM1jԨd*߿ڕ;nilAy}r̅7o~_으.r F裏^tEUUUoƯm۶]H_C ݣ?˯Y۞3V>}+SUu/\vҿ;4})S&]Ȅs#[[mڵˮ6_W[+L̞+\t鞽{Es羰fU._ ̞}f ohUW?ӟgk<E UyYEm9yƉSϝ\jUMu%K.dp_fՒ.{l۞1m`Ɔ_wwVqCE+.=ۋ}g?^g_zAn|3 :ż#n59(%ɰ mvU Uqѓ&ݿ{l ^Y^ӟڙs]p)phi{I2)C,8ZPO9 ۶đN DfĴjǬleˣg$H!cey5R`Fz2DVO<${+d C *1_C4$ҩ@s!r x_7x~gM#u&aǫ*EJ$=+Zsڴ)?nXُ׿foοF<ß0L2eڔ)hE  =k/?榦A!i>gO9ۡuZV#F9D#O/[va,trIez[ZEaUWVxMg0>.kVungޖADŽc1.`! !Ifd$ N r~j#  `8c3&m BEAF^xO_٠pX2$0d8f%{rAIH,),/5Lq2G$wu˪+eLTU泠7~d#P q qu8TH LPLd_c `@I2RcpJQaG F8@kw8A˜9B<3ZDT$$$U0Xfc"M*Hw<,3&TQTB8G!q`X 4 Ha?@dק# x0g>utÐqιOYPjˋK5UfD2d-l(~"lFTXiAQLCpvtF6Ww% lo"I9EP1 ,a`ö>-!(rynF dpCw&P~G~y7| C2vEQ< 9\M!8K(2VYOu~@L2@ $' IDATcQ*qayj}_dyHskW,j4r.Q=ÐDM(SI$C9׎ܯ]wݹsڵkPAAAA[ Q>vxAAGiFUUϯ4uh@_~ymuu]gr!S@q`4XC닃Thʲ{kLP% S!%pSm暆ꪢHDAiF2i $t%Ih84 `.t.,qp Ϟ u ,B$L@<6+q|KjZ !+8%% i:Nv~&N]~Z| vgm˵-ғd$a MU !L&x8 ƙg]U=xaӳW7,ff-GV4!H"t:;~R| gnU AB cIUŜʲږږaM[[G /*,UP{2=ɬsj&q$5 D$SGcA`!$˲t]G龾jup8 c0{{{{zzB,2 ɲ,2cLhqլ &:˲*+ (@8 Y,AxP<۶MӔ$I\u]ea3$qmۺʒD}O>G\$'mn%,q Aj>7}f Ӧޝ{j^UU4|o۱ ]x:ڮQ ֍|'[ngnu[^{{O+# Cipåud$N̲(jkGCMvw*RX\$J wmD=JqO Q4JTl2RV O/ԎlGCRe.d\J2x%Y,_叐7r!jKyMM?~/^O,֜=k?7K.?~蠽9] d 9:f?3 yJiϞ✋H8G0$-DԱl3J)"EQM4}$P4la SJYq/o6q' )g꬧DTיEO.>`zZjCш<%N=QcD0\_0!,I8n(〱f) \Ò(Tdp ` cJNc8!0G=+!t q=C@}JHuUBA8eIӞ 02}^ Idԇkt&2+dAD&96L-/𒎝Ɗ8}RDv)Hp#ʈB8gi72FH~0MU1"HMA'Pb,Q˂;wݻW%Xd4Md2" XbӦMGB/msiii9q℮뽽ikk;vXMMUUUg~VX| v~24Mwui_kkkE\`YL;::4MSE28QUU*dR~cǎ}_-++3gΓO>_SU瞛9sfCCB'ML&#DTjĈ-ڹs͛ xW "HyyyHR;wvtt81޵k׎;<ϛ>}1co8Eavcǎq kkknj#2 uq$ *-Lj&vwwB~#pǷK*|º Izv"k%+%@&BI;4*9*nS7L0y괗"҂ǿƃJęו<*0tO{w}/2{m> Ցuͭ6j(3JV 9p31𼼼y /}ڎix套G&H@gG/eᐩc]ϓT4$ B 8HT=5niڶ-p܋\TC fkgRVȢ>w\5k-Zt7w}oVEEXxg*++-ZfͬY]Ao۶mǎtk6mڴgjʕ;vU;6mڴtP(׷vZYKxSrgԨQ~}}nȑLfť=ܑ#G~ahmmM&6lضm[gg2GMo֭vے%K<ϋb]wC=}oҤImWTTlܸq鄐z4kepO]]<𯇍8G]{]Ymq}ӈᣟx=&Oc,IǎmܸyCTϪOξxo[W=;cU=o][#ޖַ'BᘮȌrEq$Yɤa[)@`d8d]A1 L38Xl)csNY& @RJ0ȊJJ(l؄b-QN%8%I9p@0! `N}F Jq!RF=Io}CA@9n*$!OgƊa2gkzO?.$lB i"H&lA5jƪ)..|i_|q^^^$[ þ+" Zkkwމ1Fpxԩ]---D"SLyꩧcyyy$-YdΜ9&EEE&M3feY&Mjiius .q?~v[SSض}ZjĉK.;w.\s޼yƍL&S\\|7~ _e讻9.//gE¡H1u0S˗/ʕ0ywk"WT44LJ'b1"pQo,*-0x[Yx-ʀ7cܜ]a232V]?f S?83MWf[0yĴU f kn$I!EDk7}[=pImK,bMHiU׾wgogͤ&0-,IDRиӛwA2ccO1lh_{v=ؘqcTr#&%GJті\ՙ qwߔ2@`,3ɀڦ(\nry-UnMhUqaWpݖ4$cHM$TfNqǹラL ~?2{L7 j˞!L0lVioO0L" HȲ-.qmT#%oo)"@Qt:Fn2R BQ1+y@8uvUUj)#^뭜:-|;S\Μ93;;j5/'oj^h G9ޑrF*KL)eVJm\",SU@#KY4 E_Ǖա6'`L>bEIr1 LD:bĨjwC~/b=۱L hjLҀ5e4(v}DsJ~|JRx9ro\YY14$pۿ^9Ivιv}ȑZD\YYɲl߾}333( kCR4(y^D5W>|8u/6MTJJ2QQպꪫR c̕W^j\]׻v1ZkS!{%xUU%*p!Z{.L}`]tQJCOҼ}]ved''"vt:H}EQ,--%T Y9UE ιfb/pǽs{X;۞;[peYM樲;efy]]ܡ |n@\t2}L _*1( ʊ3wY#P\]Sǹv{:0lhW"R;L06C` &-ɓx_/|岽TaRXH DݪXBEp~m<~U1.PO*$J 6Du[=~ʤyew8"L†Y+ ZEroԅ&ukuu5"˴קePUChu2cI˓Rp>+H"1ҦMDmR- !DRHIǠ" RJ(RP+$4U͕S=)a!)=s.ZZ{燥Cjs$v:v(MD# cAEl4:2#"uWݮQ?X=;X[5{g3D%"|L>F4VU:|+KKK{k&˲^y"CyRղ,RV+u&ZV^gkmetVWWN,˺p8<~x[o9"6yƱc2}fD3He'NxG;/|ᦛn:tPJ,sVKkK]"`=p8}r\$ &nE8͵N3;;[UU1E&;z{AʭqWs=~ 7j|ӧOL6veYfY6&sfff85QK}}ujd TX&bQjuX暚"3ϣxk@ֶQAN8VU ^hBM 5H\UXt:Suo#[j<3hUEXwDAɪAxWֺV:Π .z3@puVps&bf,WUcexC ӭf=MƻmM7aO[}>A8$=_ l`WSYf&b'` klf` &; GU:]wm:̤R*Wno#A7\*õ}vi;E^XVH̼rpH*#!H&v{:׹ t;ROSdK)»\ʔ 0 ps-,1vų VVVzffVʲ}ϊ݈wsTuWԎcB؍糬K]\j Q\ 13!VI)11">jeU!('֘uY9ʸZUu+k7mBRtF .Kqp>KFV8NiN_u{Sp52P-{ [ h-_nR:u9׿n=zt~~~Ϟ=Jd0뉆N *sfNpJ\siRou0ֲ,֦Ƙ/x~~~vv6i!("ιk5d)ZZT{Y%$KkDd0;vZh&njkX h lkj\yA\X"G@eY| 2 [ysа]V΅ZtF8Df)U\Y] ǖʾ8* iU E (u ¤IbZd6RUl6{Ps0:bGDDQU)m= 5AUk| b\+u٥W{罹ɘAJ!J(VrI9dĪ*&Ҳ&BCܽg+c՚J +r("JikbQFE0:!Ȥ(e^ 6`+雙Ffn Mj:k(*$bperhfQQe By QEi*`upPQ `EeH8 Ш63\iDpA!!!i[#nO/$O"BD"A̧TMkIՈU1:XϪ XADe7L__:}̧?ݯ/XrBM0sx~!HGh[{l.Ɠa~ǟ=^s1 `f$LʎĻ9Ŀ 9l##DΕ>@U9 ffr "!ƚbT~sQZ)Uxfy Xg]mK(=,& js FcnvZܔδ͔ʲQ43334,;tPaQ<ϧ&7Td9ݻwfflVUt*[w $YG\܍هQ+RjϮԪ \[G!Dܳ{3:mhhfY!$DcŪAAP PZRʶ[~?kv`أ ıhwQVcJ+eHgVgmONj6J[!J`v]4+qnUKv7 M Q{'>PoP53$2 Bhs<;&lׁ#1FF.wx~ {?S11{Q 6%&1k8%ea`"J%@J|9t6WJ&;@DmgC+#nU{"Aܨ"/ FpEbT[0Bzi8g HHYZb(  BD֡ #"9_tf^!ΨBfCIUcfvC! 3  1>zDϙV!k)EP䌂U6[U9UdH/2ih#FA!@($`maff@RJ)P5$bP"9A6{^;IasnKV &fr'f/w?';KKKJ߾6:;y_D`] 3ɮ35̘ Cew+Zߒd a9PF^#7L϶mM;{RVbIͬ7,瞲XdJ0i`x)8 "33T Qhzf0&Eylv:˭1հTjbFJkkbrlҷܻ}""@M:q1Mʆ@1 Df$Ĝ0=VJ@7+7 M#.K@0Cm1sS ; zv~f|Ki0W1eF5~]ԃzyW04aϠkkh[3D,˚P膃jX3+*GEpzĀl\Pf&y)8R63WXO`!.1 ``=a cH((B#ex/ (~ST*Q4ijrֺo5̨AEӸ!HAQ)_ptC1#ESl q\ "EQ p@2ZkS-sPJ9kGJ"Uc1,AVi102i!+5S!0[ յLuLYCnt5/ A "0JD""H 13k"!`"ؤHJ:($v@%! QBY @dBm%BD eF-k7x ^fuRAv"&CͰ@{Y kc!iAI"(-$1zjfVcpͰm1FQްBfu~]:QJb$ !Pn Bq䌙4A%[!gEQ$6RnAr]YCPHPiEHHpE) e dqDy"#[Q$@Laɷ!{HJ?_%L0]}eC.u}ϧW.Po^~׻|⦅g7'%?sݷssGz}7uc?s\}~ꮻK c|ݎ} _o;?1a}O|WÇꮻv 9_MpddB!"5(,! X $gz3m2m9P4t-I>̬E=8pvڿ{z.B_:uU@ V .juڙ`.ݲZו[5CPgϜ8. Bc{rX%"taMyJmI2sD!ZHDP"bb]n, :dR̠@" &)vPL3@JIn(qXqlIg'( ;hYc"SSUN)4xctDHkEMvȕ e)@D鬬x>B[qxs &.;vU""4"* s]bJ.ZiD{' $6ruh蕎ϬeBBJ)BXGQm.xalZU5#r޸@ADhd1{PM+R4!ytO#v,FB[bs+Q] C#hEJQ FDPom.'` &8.j{p}_9_VZgYf,/WgLLqdE5d,Zr|_9JqgyisSW;<[ʆ@m X2)$SA+Dmj6Zk5, Ld&v ׶qQ&NHvu;?Sގփ юeQ0 F uCc(}=t6,6ҲѺVIY[}K6Xbǧ$OG`& A 8ܐkS. l" [ͩ}.(ÚϮ n7U %XDPhՙ!kmܢk]ٟ_~݋^4J>>?aA0绉Zj{~PaaR6 >`l_u36u1*P|lh]d !p9%9IADvpAc3Iw;M8mւm nSj'AiDR.` 5Z kBhV{e(3c\]+c 3lJ:>2Īa]{"cuLzC"Z\L2*S uKYEZMhN}cFθ1u(F>;?ub̭VF;rt~հPm;:oN:GMg4IJF;Yʙ~UbZS4T:#ݷ3DHClln-/|ղٞ55:"V$;fhdK 9BJ9FcRi`QD4bˆ[ul,Y!O>?침Bg*ѣT3PFg~g|J$iF2_W]EnlLY\$I%1xވظE! !Ɛ8U2s\hBKzM7vfv>p U4U_O#W^Y] vޒZ;}OW]?{ubY758%koyknBZS?z{}"rd#WI4PDDUPDTkDXSǾ?ckQsQ!JgkhT5jo@L[ɠ0¶ do,@)gIv6]ln M#=C0!f35ݯo~CqK>}z/bw,@QUӡOٳ„]ۻe4 &x.pСy#GÇ]-,._YlW|_?De(v<>.~|v;>QOť7}N|/\}~z =: 1֋%]Ȃg "EDMHeFHD50Cd"SFsPɹR>fNJ#A8X!(V4^\}5 ! " gtq$ $KD Dg( )%K@ F bd^$cf"Q87#3ksڪ,Hr5VnĦl+k CLBH6 B0 qe\ZbZvY[Y,WIݶza%Aܹbw"K ZkTe=.VsK;ULlDr[r޵=vW/ކ;j7WCixc~lmLs+׽?^<477wc=ۅo7--sÇ//>p1܉'ss3s?+/9gテQi U= IDATw~K߈~](AouuP}^R4Ǿqbyyyiqquueg@\5(JSL0$Mh &/ id%5/ E ׾MXcuyi VY.0T>jt k\]E"&aRBh9XWHkR/~hd][9Kl+kXZF)ft, FhQ(1F b4Hus~>r],!'*fL 9lb,#(c 5cd̍57GUWBkR!sV`uf (ml `]z Y%jL-z>"ɘY *ӡ>274C1(n~\]1Ēg~Zi ؀Lh5fӇ#GKC`TcUk_}slPnJq\vlGcRР+WZaQň`2L= ig_+_GbAI N+Ε0f긵=zSGoyBhE6Bعf΢9"wP!m7[mL< &+Vwa +O/>ճv -)kGf?pyN\:<:<@F[wxO<N0>rw~w܎>r֘|[^۫z[.y{7>V+op;6cOcsTVfOPV=NubFѠZktJ]'ј9ܮzcAذW 摎#l(.0'3\UUJ)cٲtCEA t.`X8Y םjeFGa#( -B͌,+Tfsa9[Ve{6*ԟ'1n-j;s 'YT4Z4UU9"bh^~e^_ϾoFr-,pEWVWiwk߁%G?vvyq( /O~ug:+^񊇎g>7gb<@]׻vz_G}]\o|cg^=/,Z"ۻ]=PgVW.^"W>2r/~(2D bOm ?vƷɷ)0R#")-ZAƪ骖A)Eah[Y~[4-/Eb9b2ukVhE63 Z_Y}He:lӸsTynt pd6'PQ?<Ўu~u۱I6?>"J"@Ie!`B̂ zdQ7< td0Rl9}B|qlf!7sRO M'O6};v:4'O:4a~.ŕ3}^?#α窞{K@PjkW v=3ˋsV;dYXXl6y -#]0N2#@"kr  .^qp 5WO:=hAuel4۝]g]ca]ׂPUC]^9WUie2:33S8:v%.uWTvekUW >|gΜ5BwUt]9qt-Aٜ Ē)  zm6< }erXǩKf/Ec{.NJkW4ung.έ~H'/ԍ H8Ѳ+<666[Rf0 ̀e,ǪctCG{:V*aM6+i)U8W~1tOOO[s&ALP@ r:ur}uN,e\,T><4G_/~mŸ}6;dJH0,J5TU)AMEgpSSc-O:ܟOnO?н:1b䊍+s?_8gƽ{^#qO~fE&H){ #@2nۂm|mϓϽ 8 5)Xg_rjGÑ K, m  LrTv}Nj,p岝{_}M']:|{7r[U];^,+>i+oNC=8fag'b1o___m~0l|Ot5w/ % ¤Kwq/A8z.k$_Nƌsaj77f[{W]lje`AeUPHfJ)2G3V:DDC41utgY#7`NE-\2Lb1L jQJM97'J1&L !QN8y8P Pe$2@baMOz'p](L&a*k!jos!HO09WgjRj}@kM~*FDkV`PzA:-̏ٶt:d(H ÐRꦒt*Lf0 %"RGqT'*,"‚\sCCCeYJgLrFèh]72e ZJ֒=o}76w5C'f4QH; H2opo/=r8}ӶZ/;w_ ЁnʤW_y֧xqVAY+gt6bY k{^QJuο,6n֛?p^d v`˹LShmmhoiYbE689uN77O|slD.Z\.nw~wNӏC;[Wk{\ g~oE ?Ypq?sǢ='jq'akm˚gۺn#W]wS%=k;knn>zha|'?_G瞳qɥW9j#k֬ik;Ct+u߻;?2Ǻ:99yYS\}^̏UH)QFcG䟾;zdۿ=:wȏiE>_}ߏcE)u1ƫJ뺞755}_E.X޷`aBHǼUg8oO-^=ǿ{._Awg[hƘR?{llko޹bY NTk~Y7>N]xy睝mήҫoѢWBj4֩SNyKY^a{_w|&}㋟QޑJi^O9fY׽?Yt:~6O}OT kٸԩS{)vSZQ\e* VV;D18#6 %|S3s4>+6iM33ApJ84"{ҭjjBR677+8JRa*Xih *fqh>2 m)g MR4ƸD UʬH|kwD*2 L DFqN`R! }be[Lm'PY/%D$D%AЀ1Jx1299l4!rq~% t*ېiLCݻwtsKw1ZsK˪e84@rLAdY˲jYjJ_gg2:XO ttaLИ( 1cujDwNxՐ pA$RB]Ձ|MN`SY ""E(s 4t-nN ;Ԧx䅫EX0}2u^nݹ`6LV~dy:;R4ۢs~wϼCQJ 'ѵp1w 0g9w$LcGT^1v-drc̼^?xy|gVVkλp񒥶%]{ \ݶ_pҕKwutjPYɤEion7ag||_ғO hTUs:u7ȜawR1ndwZ޷YJA0BcdE!0D@OSp &42ބY @r3V;B!T;.@13ق[yfVO8gSKОNɤeJZR) *Rkm\.b*/N/rKkS2"xhmt2d$C؎fш&kd5[$Xqn\iZSN|h$BM *'h5Jrb0PkU/nnLpTߤ IDATtE$A@f{d:uԩ 8E,\p%Oo:=/WZXAiuRZk2tv^ڵgΞjZϊpXCRa,!VPSf)8/e}ﻌt:VEo}ҏX4`N:uWbzUbg7NvDJ`V VcT~7 `_T\|VρNuh8ƙy+™w ;U)L$DNhqm6)2²Rpr9'JFFXv)Nmtg6: z23M9Mt"!WӎfR;q,L0YiPJaT *QT<999(JULF M(*r޽.\wѾkjq ԒcRZQy81eq |)˜Fdž,˲maqJ$5cLHi*m"NIr8ۂA0 "1lٔYir6CEeY!co#Ť֘K ɷ9>V֭[OڶmR%Un -m4RΩ*3ƫo|/jU\KE2֔2BH$Vv*d{{bۖ'Z.+N{ԲrlnACymI+؏sm]~ٶ:#b4kF.'0Y@J&:(⢫v=O_8zsave-NtX@-Y޲ɟţ=>{l5Lqfp]UdA)b&'(: UKs"p&+p2T X"=_E2nPb(d2cZvK(drZFbؽ5vNNҨcQFa,^%Jahd#MW1L9D3܎h @cJ1İBg9S,9w/'ƸXLd -M%Ltuuyl$"ffԔ6qVڏƤ)Gf8F<v& |g@Phlc_%BiI,S 4 @%\6PŔr!8b_ &csI"$N)cJg]+9iۊ2]{F2j9M$rmYeb =cCaR0S}/Kt~wQN:u~C88N>?A+WjTRZiG`ֺfqоg3j QoUnxAz(2+~DB.8][[=Wo{i]v񍗞}羷sTN:uΤ&,Q7`{ g!iaN'#"$R<)1A#"RqV(kNbS O)߹P3FED)cFE 2 a;L(8BrHM {D7TSj("}7#+!|~br26`9 '*2f`h,\400d,, 2kn  L&C)5>AqsrR¤TJLɔ1QX`Ass+{v9rq{GQmK8JEؖ2\Tð~Jgr64--_9_D#d& P1ƨ"A_Z]w~˂\sm[)wLՇai::8 ƶiJxHi2WM<ӘЉcظ7?pp =\R`c#_GP Bn֎ /|#tКZ1P \lj[Hs^wC6z_ط,aLxLJ"APMbo}ѢEׯrǎ؜8|bbD"+&0PɪQLT'ZaG,'ŅIQL}EhBv2PS5_#CM @>7h :+k-1w.ƖƘYat2:ѣG=/T*2KPJ#ei(F!m9pcԩSN /~09^[ܳgUW&բ]tЫi%eZKTRXƃ#LӺǏ>c|.o};VYs?T_uEkǒ :ϧfW-m:;|#zKZg8O'߼??6oyg}n/HRK[[[3??sソIk&"756R}gƧ[/g"6qq.cl+wJ*PDhf7hPJZ{ */81PN]lC];GAӷ;={rlcmۄ2 %b~Η399K;^xe|%[,Zbp`p7?빧T_zWpm{ء={8D?Y_ۺŤѓǏy/O :vP2ז˵fIS̞ӻ{/dٔ}+e:ď=C{ի&G_ؼmǟy'^۝rƆk=/:{E (2NfdXٵ' ?3| w|.Nuخ8|h`p VġÚL{Gg{' W_ڵcՋ{BeD S{x;skQ(į:v^Ncddd֭[u^~N]N:`P)5㧛0F jzQJkcR2|om[>5Zw< Vq.8Y@3,h|u8_񗞑:uC_Yfux/|m;G{r˖\nW.m/?'9˖,x֩v|oooN;'{BnjinՇz&spZgBtjY:;t!DZV6LlӻR Fj*%^狥Xi$rv8P,R`n-n;ZDUJ`Ggj|RUHЌi3(%R)PD`(K ۥԲPVM) ctx+Hf=MR !sN)#$\!y7oɏ ¸%0@CãC=0wl+Bwg/xcn5 {>|$Ҧf{׃TnCRPjP.;ohPH$T9)C4}vbbbttt::_P4UsGG?G^EL*זK'r 5d>=81Wͭ]hn2߿cJ݆ɟi@? ƖyXQd<qɥLLnVơ@ŀlS9L5K'Q)p4>8p q sDkMywͶ--~w/ܔвd~= 'Y +DU7s/n "]Ϋ6^h] )-s;s֮reN6}dͺ [RՔMXҗbDd,}[N:un%5"8fhAS )n*Omy*(VGq<1Qܰ~. r3ƴk9qlv'y7oleUW&&r L6-Y|޽/]7ޗSaFcŝ;z䑻~f߫vzћ~~w|#wlܸpv=#ޓ5 }kw3E̶@Ut*#~Xr1CYʱ k4B6*HLu0;`4Y8!i4 "30^D @O_M 8HҔ h|!`!0 "c DVF@5}UYRߊ❪jifjS`"8.\+R"8q#R.h,@,+ }4vԌ I U8rJ)ERF2&JE}_kmٖqZ55$S){p R*Ji47G͍Mm;vYJ Ht͕լPJQ8P:/|JX2st7U^?&oumm;oZ| bժ}OS::m_|۶oayӷhc?[ΤwoO7m檫֞}zOwߜn mjˋz{z鎎\.ǟ-H)Q$3ÁڲeesOtԙ<裗mзhkVZ~Fys޾:5~4[LϝԍlF @,Oq G##Q\,{^$ f !t ety3R)n3ty֙a ə)3vW "ᄸ&4)}0pFBD!6[R@ `@#Dx<9*x`Aѐic-SM39%+~ n)-˪60JaΦZ!DpF-BАI'\,Bf)P+&X%iⓐ3+( Z3QpfQJcQHQc'R,)xjDc4, C(TDڶ-ҩPERNnf90~LjAiҵd)TDAFYwXZcHP>&¢&A@M@.)@s %^%KZc@9ANbJicBїh1218/pά2z(˼d9Z!$>裏>^ !7oz^vvW>vj$R^,H= ov|t߼qU{xgf߿8h]s5&=׬"? {>>ugwaի.yONjâRjӆ f mѕ۶}+^Cw~Mo|ӻwؾm[e*b7l8xЖܾ͛BdYivZ='~X36l,̲]wu]<{OMV?x[o%jnǢW+Xꊝpx)ښEzy K`Du!u_@h "") r煴bQwf+x#v ң+WzE,a趗O D&""!P!k0RD)4{|q:%HDr6һiDD4~xf "} aPNMzsr|V @Df^uk%?00ys4 qpp9$ 0Qa&IlLLoB(csbHĄ  @Ž8'KD$^D)Ga ͌/A S)XqpӑF;? ("oKFW:]W$@qǭt[L:)R˩ʼn*KƱ +" ;+F' }f8γNP'RnSEuX@l M:$Gyކ @BVP=Ɉ*l$u[w^P5"*B)rN2 %C6kw֬53zRχV1#&LYVH16Qޖ C6 sӤ UX[HeY-G 8t<{ PZ!]>PO:,JE6HkDQu&^iu9Qy?Y#M [:525#X֜km*!By <'jĉT>"g4Bl2 U(2JS7DyUy:HK4Jʕ JG}?!ellly!r[HEyx" @DvW}'+3/ = T7j+__ჿq/m޺^w!n}^_?d+ijGݷ;w󮻪 MvGT-/|,@"h{=R %7%qyeYox'p򋿸l _==\<39emۖϲ, EpAn'LNNLLp偘HQ0 {_q" 6=|O)*œ"#=cπAYV‹8ֈA s^H29Xp^u@<Q"TfAXs̵SR@l%{(QJרּ(D5:(.yBeYZ;眰R ;A`=("QHՈ@ Ahf " " ps2)/BVآs9.QmbjXLK8g֖s(v" d)J$ZjY\M YT5xXRq 4jE"TQ"  hŨ4 H ;V95):i-w-M<88#UC333k/n6; Z}<0 s4ꍄ(CW- HmfflK F%)`L F (eA bNTHX},D@ /^_%\ ebLjS0Y) 9{@" /!q$H$uD)3Qƀ'fVd jO@D#QZ 8c;pZ((t82Z: R{"2FpB 8@RJ471p]zȫ!#D%(nI "HHFyx;)D2'RE@ĉ!] %!>eg] (kT4\IEZ!b{:5D3Gukݮ OC ʲ4^kWIH58,ΗPH)"sk߫Mr& 5c-B"hhbǂ%FDl @h5 90)P8@@d@bnA$ X[Hh/98>裏MÅWn?<_\s}Y5k֡oafz?q]O>{w$R>~SI =Ŀׯ^=zqy]jqW<ܩ. mڝ_?(>йEOieAgq)Y+b6$|9{Ϟ{>~#+nak?8a?ڇ?A_}۶v~ IqYk1EYK$~=[k>O-{uNBx/vYIعFQKRD"(buv[vz2s+gf$iZ/Y HP+ Fy6l&IʲDFZWZtEQUINF"4^٣1NfFDEqUY]P`g/ J)Akx .sr\Sy ȋU l}YB@VVYSe8u0#m""1Hy aPJ!@x!f,cfcV)UD*˺\I(XڢRDGcNNNi Z[6@$ "j 5g,^6^'~zz'5fFTff(NҨyGqs.C%4[ݬ(G0UNg  +̬ e/ EjIiK> K ԱLv䁪^a";U/DN=D""uHIPhRJW)fD{4BnH$>"+-& |Q:F BQ, {F҉%Ю8 t%oN5Z&YXG"",1" +;(˒-U /tDD QNXX=( C0J)qJksZAZ h}d19IX@zI)("j_xbV#Zr\jB$ꑔP/AR"~)u>vZmWl}oyv{/楿AU"Aq^K.06F8n~moxsssg&}ٙYBTZ?UF..[ Իӟ}>~Wꅽ{_ػRmݼyrjjtժwOWѱWn޽WرMD޽/G.Vlԛ۶Q]{_}VmXcziǕW~^}uA|6nذl?'w?tȲP 8zطwj%͛8}۶==e 5cjz?CCo,Dn%qb'N-۹$>Kߏ"uk7m("͹GycW^֭[t W[u7ߙ' , ׎ =ztrfVb='N@Ej[Eܿw_ãq9sA@VgfpӦMغuk~}~-+HEbjYLJ=RLXѣĹ ThP xc1 AHF 8VŸgp2k j^R%Jئ0z/<DPJUߎLD޻NAGDXeu,z&q4לZ +4.{ȊCAdO76ى3YUEeyuu45Z6==S݁U f 333kӨV<36̨YvN"*O9kK紀9{1K+$Q~b8UVx@$Dݩ**S*m%3E7J  1QOx5VJA{T:2t,"o}F\AD d4B1aͬCY38:R$Dމrvd I>td!rA2FI@$2xτj" 5xv()e;XR "0WQU/0sniFQHlQQh<&IUKbFaWR*{\ZAD X `=AmQﬖ=2" !/F!Ŋ'݊V ,D|Jx}~Q}G?X j5L^R)U؈(z$Iιu7vٜoE AH8슸~ |?!{>͗_n;62< oo _x+_y_ջ/0-7tWl/~K}Dtիq_צGW;n>'>)ܦs!qםw~K_]v;SZ/~j}Zx Z;,[K[l?V>. e޿Y +"8:V8q&(5=' BLD{k9,3P>ݏBOe=&IDDsξ(U+)^^nnYY}G?~8\Qy!|?%+~gzǽ DhuR{{n߽ ?v}ra9588$ew]-۶of[]溵kwzOiOuvvF.[],o? miOu۷Xɻᵯ~VRaʲj]e!.{OA++Js*3,XfI /u=zT-,bL(O IDAT>9OmپUxeEn;Ւ4M&g,&~ byn&0 o?0tU$Qy''_-8/UK&;\Q>|= yThHy-}DNL QSE ^tY]o U99 / \@U{qFQT"5f.,"f@mv7d̬S Y@P[PVD">xhcp.rQVvZ- (PJEEQcIQZʳ2 #@DyVh&!3Im -}aKAZ+YӒO$eIx2%yz?2";PB+:DX|B]E`Fl$DHd5^4>$>JwEp(̤FIEl%XD0,J9+Ul˲$"j@ |Y p @k"mLYq:(j:dF,Ç;"ZaC'o6aZP+2n  -,1D=yxb",9Zor˰P.۫<{)@j_2hDx҈ HFIi 6],o΂ lhM%@,c*&xL_P1,Jd_wpeʲԚFvN^!sdѴ>3=)(y׮]g(0|@-ƍ7<űB  Z6(Mh!d/$$ye Fs~VUan:2"seaBM :++ݏΎ@A`8UV1_d#dxX"NyDKSUƩ6n ~I@UjtA F+8vhϞOz7|ƍ۝dZCϵW]uU=IYq(ޗ@ha$3,aWDz a4 'NԱ#_{յ>"!lˢ̇P %S% "`"]?AP3q|b/WիSE"ϧy{75^-7@1F)e䩉~z߾}W^y[֊4,˳T,v//&-loY9Zr (D@xY;Ke U -Q.p}®>_~0 ۋy->^&3߀f5(3,P1qOؽٙY sV-[(V {ׯ_ԓfmy"&شzseJF:\z7@ȱNAZzFjUeY߿YZޙ0pεZzjWn߾xˎ=ZiK̞QQhd`Šopً * (aA @S}9̗L=ƛF׌4HxaFz$-&J*-|VR(Ij^3<<6pr͚ٹ3[l tnzUMWve:XKO8ՏztW^䓻urrsf944TY{ڐ!mX<%P8B8^i* $/ eB5.ADRF VueZ F( FQ +ͯ:3yU[) BWvpɇ O>_W Ѕ@!,$\u$%)UQVFFGGٱ9\ZΞ \4 W" LK)XbkR-MWE(;wfYn3Tqr^Y<{oZk˼VYk,K?wu׍78::Ze%u\YD=.a.DDz =-X0\_.KuG>裏>~ vnv^};~i}Ǐ*&oؖ8_+*ZϷ[l{OD'Nk/+moӧOcqbbbrrr͚5v30zHY֙ CGE uN̋IIczjȱSZMk}LZ-/f''';lƍN )G-rl|M<>>>>99tpc/PP^h:|YK@De -u *I+D<#4^mT)!:/c##i[11KXgG:w"'y'<( JQu'zk=tcG7=l5z}֭}5?g,kY n  w\}CuDRfdձcshB4Mҏ?Or5]WfS'9sf8Ly5 ^5Bk֌N>e 8RԳݏ4 H!H T[ >e )$/QAA/, @H-=+DJ:{_kolֱё+n]2cf $@/\64a^hӚذͪZlv9"dzkE"QE`"2oet[x׿v B,cHzC̆,W4Xs ˲t(Pa^{֭[|KaEl4'Ϝ>rw%xW2ZOLLLz뭃[n3t*etu^?( VXU )-%].]*s^=waYS悔~ SG}KB{_}v-Ҥ>裏"PebJԛ XYYa g!(G0; +<{|K(았ȿ7h$M6]g&NkcC$b`qd̡cGg^KaR. d3{*2[Фf> Fim7{٣Ǐ8E]GQE0V=X*{ (,{@y0Tձ-xe c΂@f?yq{A11"PӭV{(s=tp 1 v/rt )Z.G!a$UxBʋ D(!2*R:DBrkf[ZZJ@Fa:j#vu~_Z17t1TC aKqtd NY֣v4XT n2:;@mh{ܱcG{qlG7NM4Ήg6mj]5:gg6]7{l6G&)@ً $S"Q@:@%D@UTå"gBLUP``͓% ʒ0-#*bR‚\imVZ":|>jǶnݶ肈hYiM1Ra=9Cëj H)pDfprU@(J!Hy/RqHYJ)2qVDyEX[*#c,K60s ,ZVUk] aVrr\V+`Yi0r69<{ C90t:aViɲ,"s.9WY.T.&x>裏3\Du}G}LXQ#p|3hA3_\YE=@2sD,SJ0`v{A6F᪑vkćv&aF(/J YY${EZ6i7QQ,˼\P/={XЕ34wѮ#,|G+Yi3L=I{trw39Ӛ8Z <E֌ fX}"/Ҋk9[ d䳅F$QD8;31<>;W_yvۭVqW3,1*ٔV044 8mUV?3Q~UС}Ӂѱ5q~NNlO5-y#n€#:,(Gje/nZkU}Q9"IsbΈѵ-,$nɃ ui:zWx]{Z|ĉcW5s팭YZ):ouNgKEc('cC<8g[#G1ʦ-Wv[sɚG6t\ݚڳJë68s9=rrkCg*;33336K#i\"^=rEسsY{6'绝NgH}lzZ o12 ;5ȔjuvfSNL],P: Q/K$ggg~wav]\V=vƍFݮ^wvk<${AT>^vYajN8Q1z֭i6Vkݺu'O(";vTDZ'OuD 0I"6Ƭ_s8GGG1EQ_2C_?}Z{}G}\ZO\gV%pTY*PF9H,1KWX/Jc]9?=iWX#Q7+ Ik!-n{ PfA 9HwǨHjJaeQZk0D:}E;. e;A.ij<ԒW%|".W͊xgvVm :lwNMN\/%D񱱁FG_vtˇy>̼XۄABm(!E~`sǎMcj ύ 9rh9-ګV=p Z{Bf9vx嗍֐KqGѷ @ٚX3hpp"ǒ1i$'f&'θ"hO8lMuFij)RĐMUWK^}"hPPUb@$T~q@_w.= 0 vڽ3[|7_̲b#hmdP<왙YW?K~ .v+u4oA[>_1~_?&ɩ?p}u8P;gc_WFʒEYk'o"ϳM7]qNu qd3O>C&{-۶O3ηf[̡x7) Ίx-QM0$Ͽ}<7pCSSS_͛7u{ꩧy晡}c;vFڽ޻{F1::#9s&"l64e扉z駟zw =CǏ7~7p1رc<Ç4=s1*\NۿGydttC_˿,CPy4v{[%I2=={+_yС~+?Oe]s~[c>s$I'Nxp7?#7377www:~ЇZjժ/˻vJdvv6-zӧ#G8p`rrOO=ܳ{uܹ+_*Qd|ك>X }>裏Eܹ9,X0^UTZV1kTsK Xk-yun;rޘYU󴳮"vl%@D<ϝp-+楋" 'X"({+/B!d"E{񬃨u|xjLP$  Ižh `ib9c0IhaSO(33>~"I( ggN7v)3?=Pd)Fi}mnkzs"m`d<| `FęSX;S9 _G('OOe?·yG83qHn6ۜ9vP}xĄ-ڵ4$z\#p82TLcEάznxoC &H'#nn),C~g׿w ?6˯o}3^;W w?C=nz+_xaλ?;[v\>uov{ʎk~Mo]ext1jMOO3x[>q[n;~[S믽U~ͣͷ񁟸=Λ7~kݳW{~~Mo'#׼nŝ ]n%99 4bUAGQ XG|g( HQLFi2NI eջ\wr 8#ٟ|*g{YO3rMPO%W_f P0ALIF_, G}؝w޹iӦC=Tk޾f͚G<5k>=CG:;;?nI'tgcmCien ,;Zjuꩧ^wuRʞ\.`Yf͘1_O?OOf:sʵkq_?Oy6lKO>;ņ jgg</@ַo/]tʕwu׿ۿZ;ꨣ>.lGvag}vR9.xo?}a|W_}5!dpp?>O?(cq:蕼N {8"^~w<şs_  vev 4h'v[~/o͗NgRʣ&dz)4OLI'0B 4IpB8QʝHUD O֘e ֌ Bo.dB<ؖ@GIE)y~& ʲc#^4{DI g}L^2i} !P#j@ o`*!r=MB3f*iSH!Cah@h ;4v<DQkM("2J(p(JB!MӰV+$<ϩ!PY.Z= .E;nT<a.WZ,|$=VG̼ 90#BTJS>_#HU*Y:"`Qp/Ky[hi˷4s) Bif aa*>CF1A 1j*K'wmyd֒5o [L8q mJc7鮟_-9`.qTw9;wudw>=>5?sFw~O;}FO7gҥKkBp衇[_y:;:q喎+V,Zs'vR&Y66bS3lTYfwȯG8(zCƇ_FÐܶ:wTjIf6=~ϯgR(lwh T# aZj(= ^,[vww[e-ygqFkk}AwqVu^{mX3ϟ_.O:餕+WRJ׮]{5 o3gNZ-[l޼9 ]v=3_zu޴iӒ%K/B$mRkp5x((Đ ] 4hq8mFc577W'(crY1229B+3F&*JS9*̐\&DskT2BG M(R C#QY_.CD?>Bz^T(✧q⺮d :#Y'/3^/U(xyJ400H 14|iB##a81 Q:Zڋy3I"e͑#?l?6=74*%y A@@B#!DOy5פi:<<|777O\6"IbS%(Qd9J-4͘5w$_|aÅ[0o~e[n ÐsN;0gѢEO1883BٳgX|brɧJTMrx?`ڻvxՌ1{4š ^}ALjٖ*4 Zm-2M `H$@N_!t7)"͗O^:k\93  jn'c"-z녢yQ*ҁ tx|ws Q2Fj I jDfH9h4QP4sHSs O?{> =q5Jq[f"MPri'ˀ ^?`*q~nذaڵAXʚR,Ȫ`B'P;ӆ; BeZmo{ۄeS߷X>j,Xrןp JEqΓ$O~K|;vr]:0 \uU;wd)umہMB (7MG}+MMMz]k4 , u]cL^/ 'pʕ!B7~ 6|߼[|3K.n[ny=e 4x`:!5hРA?C_2"*Ru>;wܙ3BbѢEJ;3zȡ.??W+;S1GaՋMIeth&d69s(zS؎r|~ѢE)I@Jv*JB!j\.>:42loV=@d݊WN _ycK#!`T' vРK2mfSѩ0@U`2U+^t܇RJPxiKE=b; @WW!D)dy|QY9B0JKHI1MLF.aڐr3$FDžw\! 9z.3ZnB4-|iX4I JO8R,NrP*怘${zChGB24)x1ּu~qW/fw]5-cLC/>96y+tdx>6|4R?6' RHBk'rw'[K&O'\i+vjCdU4.]]C#t<ƑShmqmۆ~ߜ?x!Gڙ74>Bsjk]ϰY;sμů\9=/˗_xgz5eZ[A A !@ @m@BИLE*rWg!0Q[>c G#Մ; &7R걑zcʭmZȀ)RqW+X\F}/Wek@Qepj**wvuΘU Tsfhj︵ )79>@[ډp4…!gtUaǞHl.FH0T#AC( J85 'T.8Q*!ؐԀfPf(ƀ2"(B%xf)jP@ jd  pAJ"CJmU2GmI\j'Jk4PPG"jT4CC`t@#m@kHQB 2 AQ"%z!NT+4#i@$y\TjBKo/{m|WKK[{E T |G:~9ܠ9k*v\`G=,[Zvv̤,bZBfvfᕜ5՞wu/5oɀ_-(4S4Whj)DPh.Z\Ek:BK ϻt)QU LxCP{jmHbp(1c(0حv/" "s$D[Jgåf;{emVwwעEl <&iIJ#Oqs,F&Tʠ5 wd}{&Jt􀁾;~gruqKNa" ۟*Ym4Geʃ]uȉ9NeI1RƉ:<͍e`Ps|77w_pե;7?@HO3u]wSoxagJ<δ4Չ[o[oꕾYKVbw'y:4z ?'\O}tێH17 #dnֱ|>O)5dYfm߾}Z4M'''"`#bZ-rΝ;o1kUVvZ&FED{ǭgvjJ)ۦQ-Yd͚5[lꪫjZ6m馛lX&ZC9d̙7n5k-*>kLjsӟ.,l,g7o޶mȈywG_g}vҶZ`2^[<ꩧ֏?-ܲu[o+bqժUg~'qhhslٲ9sZu]S`? P4JW_s>sRW_'[6z޿:'eܟx?|Asҥ~|n2 4xmrhH!Fֶ1E QDkmS0FKHPQO?xKKADdJd ф!ilgHYKwk%VZ)uHEI>os C#4 F)Т? RC(ACgٓK(!wcXR+Y.9%(T0&(&1ƹh(efT2`2MSu LYniڠB"btfP1]zT>E( (3 x>SJH;R֔6#2""e`~_e ՆQ`:i\j16b׾w*A^xf>׮?v[n,z-O>H=P'|;>|׻Y8~7nM ;8ϛ;5w桡7sBPă~{o%O=/鉱;go:򘦜so5<~^}\2:g?7.\C~~xsst|ڵz\f͚N;{ pw}WH^#Ϙ1Oloom`s[^x\.kYbQGiӦ}sGqo%K[K.+m//gyG~W^yƍ=ж;vlܸqt?kokk;蠃V\{n}tttӦMA\VWzwy===|… 7olagϞcǎ7MVzGkw󝁁C9dڵacclO /鋧5kE7{?ArN8^_rܹs-\Ӿ/ ^vY3 ~K^xap9ϟ7Uհm#~x`쏗uЉ 4x2]¹GjXQh`%j@l=Аji5`T8@! $cd= a^Z'A=K| 1{)MQAE3ʎ%Kma|r <\i$cPB>06aOґ;}wrW IDAT r= gɉJzdZx(QF Ij@™#C8lfZ@Ѐ5*ifYNES)O„jB0.(;-Q]c PĐ2+m5k.3AT @žφQ}B'%b41%jkq]׫#9Zk瞦~hji*3eT8Me$dP0Jj5J)-S!D, aZ9|PN)DM8Q3PBP)U3aw]wV_1R)30LM"!4B@TV '+0c%/=4KL) RfJRJပHea^!WXr8I(YfFC434!!%%F&/d;J1ʪxyfHbDTfuHVJxՊ -$6tkZΕʥ#:#Vh57;5G% '|{W>j._(6\S_=BOk,]QjtΧ>2|\. bcBL\^bBn-Mo6:x_Î9$a) |PK;6o9/5g͜kl.&$~h0Ja|5s|zK勝]1Yٌ9(6>Ѧ>n˖-[dSSSBR|b91cEZ[[?r)j}{_^l Qu4=g̘166|gY~KKG"bTR~'t!wܹ5ٓͦͼoMiZ./>cs1zG?=sE͛7~_>3f|k_{|?cmf؛e˖ر#Iֹs/ByMMMB_-wqa͜9Sqgo߹s+<@)%Kn;vLLL,^x---F'Q bկ\xyk9bŲ_p{΅ WϦMpb\ .vq5W655]q֮=+h'?~rõ`4_P(uQVIloo_d`ssse?km6:ݬ2܌ !*Joo#!ĦmpV̲q)eSSSsssssҥKo6ҖcL\0 ,bϽ;|:,T좆`נAo,l', &Hm BZcCD0 %I\h :y1*K+*c8 r*$ N9RAsƂ+ij0J ʢJ=BeM ØֺVR2ic!>,Thd\iqxє+ NГL}X?.=d\#% 8 "A"Ȼ~P.Ծ}FÞNh1B#Heʈ2Rj&*RyB2Sό1ʆW J HL#$i&%sL` G8 QRf*I*5pƄC"Ti x :Rfʨ4jp 'U1h% M0`2N( XLlf&Ns7{,#B5`eH)LqL(5 DB@'ھRjJQ02J=WPZ823{nPgZ@R>h)jLV@% 'ͤp$IRA^8~FkRi@è(¨E$($J :;0_߅EsgS>YwdZ"t!sȴZO<s>"Fdu(FFGh( !\WDi):3h[KuT) sArt~w{DZ jϩE,l{;e]~/B97{=5;!ly6qRjXa:S,$a+c+)ֹۻrk<(6o<>>n<9Jj6=n Hu]u~$sǾ4MsMrV"VA(l=΅B O~✷;׭[rbO}O}m?✏+.{5;jKZyή?W/^Qo?W̩{g>~xŧ?s<& ^CɆ`נAo8O8WRK)3z"^h8!D@0D+ 4$(%nO0@m42j/Rɘ'KLoRšߔeI:AcufyWЀER(yM)u}BHfa4Iɹ=)e" T&3!<"mPb4挸Cu p6֞xdcAmm9{`v%(sj\>_V4|!e%0QU|$AJU\DcbʙPҠR$24 jB#c&`.ʅ%d+Rt1&IƘy~ER=`𰶸iY1f-h,™JuuDv ٜ5ٍUMo?V;ȩ)u|E\.Wl&DicKq"[*{Yg-^_=+J{… ,I [Iξ,ˬ@idmySSSb1WU8 !!z5Xnt+ٔ wӟ:AV?w'׿r)!d`v.+_׏-# 4a  a0F(ιGu`ifqfQ C l `%q,2LJ0isRDTyAB\P Z2ͤ2z>Ug@[Tce.DR(^g؋kb qnTdł4Z)dLx b ^{SVT/<@PLֶu-6a[]IH9@|i.(#Zf^PBPU]@}8w<ĭz$0:{^s8"I2 3hs.7L[Z(Vnb8V ^O7V=Zk)8|>IFf!\׵R]VtQ`U0}kUږ=!$IbeAc4"BXnZAn5ؚ\b/JqK)0Y]16]ukC5Y͊q%[.˲ ֕JX,iJ)ؚN}߷lU?aV̲̖$[" Cǩ_4hFfΜ3/ks|{u;>xUss襗𠃖. ۶oԋ:go/|鋟_h!<ē~w̙3/_޳?y 6xMj]#tA ވLľ$K\BTt]ǠZ9 MQ@Dc@I-wx2GS4@6 1f@*7i*#$TX-( r>!cJ)p02"3(0R#Iy!FkH_p,`hYVaynLʶzNٛ4Q68F 0*8skpeڽ3 ѻKbQ)rº{(Iios 2a@ƕp,N'9{+4A,;_IVWu{od1 DAba2rl1M$ˌD"V %."YK`d/AcGս8UoW66DFOշ:U=sCdQbyZ= pO٠Pwρ(`KwOdt~T1"*DR0. ab" +Rb5:v!659P 3J'vE,\T<{ H]K/ņy{Tqȥs  TWA2o{vE1 *Ҙh =8C+PA 1F_8F {.\@Ȁl 'fG[j$[npOce32b`@դ^KWL/LV1FYWBX7pTQ"-C<ߛ'V xor6-jc||4)+qcV53 tNbZz8M8F`"5"H*a5g?tBqCEGӣr*j),*m:L,ؐ]bӈ&3ekhV= ,K+kr&jg Y2Btb:. hän3.bo-i& + MWhʹxiy>w=KT`+k"b}n,KKg 6`Wo^'=vׯ_?vo~u>@{_˿7O~ O=K__;~>a}r{ 6l;&qnD!F@&Dn긷wpx~2.@U0>ƈHlisE\/ӾyG:.4w#4mRU౪BDXKu,8&z-a'Q)qt#rL'%.O҉DDXݾ@^èj`AI!/pXe:_CWʵ?Fc.?XlYAIDAT 6`-s8F JM*0q9J_0hE PCJ $"EC#-v A~ZiyGw5'J˳ ggNmKhҸDEM{S2Jvef"s*S6Hs帺wovttt2?N'm{UD~_޸Jħ*{ˀ ڍqa|Z׷ꆇl>z>ݱ [^gBUUj2c[$IraDpzb&1Z46`ltyZ:SO#9I ~`;+ֻjShgȮ v>VUeAYhA4s3|̾Bo]s&̯W;`MYuæ 6`g$* :&Ơxtxs%ƨ3bJJ-USH))F;cX+"b݄%uI4DžsI%".yk+ddh͞2"9A% bia'AXujxsVfik4d'iҠy9YK1; ,/!;aZ"$X}"H @,1;ʀ[p,)REz=l3{ݟ6ʴxsޖ@Gp\G" d  ٮ)yFt4_0`+"AU>NdCHѐV*SzDPդ2Ysv4N{nW~VҶƲ-L҈vEa3KsvD>7mjZwXf4(oI0Z&mgӽ})^ڞeY|2yM;~}2` 6ٴGu0lf0ֱ/^FB|ŕpimՆw} [ DL#aasٖ4ۥD1Ƽ\8'ӥ25샍mFAUcYjU6uf@;|@ 3I3֙۞m5]"/ة(NDDIvg%;MJܵŨ69!6qC[$R+jn=i}uKKey:`\etD@ iX9c 㡑@g[MFLTDcᘤ(˼0ʶ=d?r,lȎgu(|[IK{ZoؽؔbrƥrǢJ-TUqԞq{rN𨞢YO呪v6&W垳2v!l"Ii_@i׋Gl΂=*vW` 61b&x'{Ӄi;vƂkY.uXP2Jg6E]oeuiR۵Ylt-R^Xcp L3<K,$v$4`[cun[؜d:Z$$遀:ܾ%K3%TUu]4]5i'EzNvQVu߼u۝frK b q=:W/}? i{D^JU-o;sʕW7yܹsڵK.j1eD歷ޚf<PwѬ~l7o<ӰWѤ;-\oܸ1͞}Y7gͥa{Sћ|hAAĚn2ݸq7߼{իW\M= K[Eq֭7x֭[/_~RP6HAqg 0^sP] ?;2B}_D.wGGD!.          0.          0.          0.;$-  T`   +  > l  20""             !                   U    n     ""             !                   U    n     ""             !                   U    n     9Va!   b'O: G l ! EFF' 8"54 V Se~%L 7 u /U !: I_y0R0a#ýn$* < KE 3TilT"YIt&Ҍ7XwW 3v؏;* z)% | z?f .Ss^l"Y 63 2 1-+**&( &''T    }      %"( )* * .    5 26444831 1 4689;=>63 2 1-+**&( &''T    }      %"( )* * .    5 26444831 1 4689;=>63 2 1-+**&( &''T    }      %"( )* * .    5 26444831 1 4689;=>697B*2iX0O}$,! *k)t*U(YeV?o(~"q(rr' ''blAVlyJ'k8J3+R4\PPHN򸤝XbH Td )>Ev N Dz6 v DrDHn )qˌj $-AJD4M"')(6ď) (" 84L1 o-OpZ% 6S=8Fߏ *S+ȪJTN:+~5$b4O45"7O43_7/+2+22x3@3(5f78د3:i><> $  $!$!%')H *,/;0;;<9<<  $  $!$!%')H *,/;0;;<9<<  $  $!$!%')H *,/;0;;<9<< W+E#K1s#s5.EA!UN#g #K*n$n .&jXe(4ˁ ),LyܽkU+/ /Y:=:;::;;;z;<!  ~;985 66/5W.,         ~;985 66/5W.,         ~;985 66/5W.,         ~/;,87a34p5r566'-F ,< )3t t0$ 3//t?OBc 1 _^~fNz  @c! C Jd|;$"                                                          0 %   !#5$(' * ,- .2|;$"                                                          0 %   !#5$(' * ,- .2|;$"                                                          0 %   !#5$(' * ,- .2:2#C!0Fy >fx x  u num?}-s](q:8zADMHV/: wdy r:/kXk"G M6a 4Xp~gq7dkM $pJX / |M7^>S >lpoDn%)2t͌5 v<YGYE >  t*?MpqB/T-8, {7T G7V(zHdNz *q.}Rn&TD$r4WXQUT p ;$"l $  ''PM'%<)qa}+p-d|,  .#;                    %  ! " '* - 1 ,v 0 1 2 4599;<                    %  ! " '* - 1 ,v 0 1 2 4599;<                    %  ! " '* - 1 ,v 0 1 2 4599;<As?#l/ 5RH,k *zdV/G 07" )8Pn, ID4wMkLSng^ #m=˕S3QC1" o}$ %0# %$57i&WY )=h5,: 2#1v /̶]0>V_b1*(3 5#8c8D:<        "  ! # %65 36 545 478;|(        "  ! # %65 36 545 478;|(        "  ! # %65 36 545 478;|(a R fX ue c $ڈM 9 OG{zޘq{ F: l@T0&):q 5e m%v w/  C B})3{/= $# R % R"dY#EL %754 5N5Tv4[5 4)4 6;7kl:\{( /9;09;:< /9;09;:< /9;09;:<;L;z:;::;4            uT:*Xavailable soon     M4XMXSSSSXNNNNNNOOO$O4ODOTOdOtOOOOOOOOPPP$P4PDPTPdPtPPPPPPPPQQQ$Q4QDQTQdQtQQQQQQQQRRR$R4RDRTRdRtRRRRRRRRSSS$S4SDSTSdStSS,tK:% box pages     TzTrr+r7rCVVVVVW WW*W:WJWZWjWzWWWWWWWWX XX*X:XJXZXjXzXXXXXXXXY YY*Y:YJ[&``-`=`M`]`m`}````jmOm_mommmmmmmmmnnn/n?nOn_nonnnnnnnnnooo/o?oOo_oooooooooooppp/p?pOp_popppppppppqqq/q?qOq_qoqqqqqqqqqr             >;864 2 0.,*(&$"^&[ڑ *:/847:5@3E1K /Q -X+^)d'j#q!w^&[ڑ *:/847:5@3E1K /Q -X+^)d'j#q!w^&[ڑ >e:k7q6x4~2 0 . ,*(!&&$+"1 6< =;:75 2 0-+)&&%%$$# # > " c&k ". !)gO !-s53uf0 i@~! 7jgQ !KOFpJri$@duG <:v8|=5 370. 2+) ,&%&'%%"$$ ># c&k#.")gO"-s53uf0!i@~!!7jgQ  !KOFp Jri$@ duG <:v8|=5 370. 2+) ,&%&'%%"$$ ># c&k#.")gO"-s53uf0!i@~!!7jgQ  !KOFp Jri$@ duG =;*9/ 654:1@{/F ,L t*R(Xn%^%g$$a##[""U!!O  IC=    jaHg9ڦ{jnM E\Pn;;-es&}Wi] p". ls:Kc  [W.G! Nst  /zkc8 ]XqD rY'B]v ]^'.c m3:y O`l~G p w n|U ~J ` $! "%'*,/ 1 469;= ~jaH g9ڦ{jnM E \Pn;;- es&! }Wi]&p".+ ls:Kc 0 [W.G! Nst  P /zkc8 ]XqDRrY'B]v]^'.cYm3:y@O`l~G;_p w5n|U0e~J*`%k  r"%x' * }, w/p1 j5d7]:}] ~jaH g9ڦ{jnM E \Pn;;- es&! }Wi]&p".+ ls:Kc 0 [W.G! Nst  P /zkc8 ]XqDRrY'B]v]^'.cYm3:y@O`l~G;_p w5n|U0e~J*`%k  r"%x' * }, w/p1 j5d7]:}]AG!M#S%Y'`)f+l- s/ ?2 2 1 0 0 0 / /, *x'r"%l"e' _Y,SM!1G$A&6;)5+< 0. +0B&3!5H8:,</xaWNK < "rd#$F<A&(*,.0 2 468:< /xaWN!K <# %rd# 'F<A ~) x+ q- k0 e2^4X6R8L:F }/xaWN!K <# %rd# 'F<A ~) x+ q- k0 e2^4X6R8L:F } 1^TN!H#B%<'7)1+,- '/ "13579 ;                                                                      uW]U.*- & paperbound     ::gimp-text-layer(text "& paperbound") (font "SolexBlack") (font-size 35.000000) (font-size-unit pixels) (hinting yes) (antialias yes) (language "en-us") (base-direction ltr) (color (color-rgb 0.000000 0.000000 0.000000)) (justify center) (line-spacing -13.000000) (box-mode dynamic) (box-unit pixels) t:-tV-tnx}% @ @ @Qp|yjK"3(@1 P1 P0 P04յP0LQ'0YYnD sЫHUɧknD sMkhJvJhJ&D)((& | }|N rĞrT mfxmf l4)l4l4r;wl4-<l4kE[l4<l4jILl4<l4n@Ԗl4<l4y5Hl4pl5vl5lT lTz l ll l _- ltl lcB,Gl! Y!l(FGl4 CQ,JR5l4 l4l4l4l4l4l4l4l4l4l4G#G#? @ @ @$(( 7l47l47l47l47l47l4ЫH-ěMmD\ԦlDwЫH9<v g"lv&yl & |l cN%)rlh|<mlg)@ll4)r;뀀@l4Bl4r;kE @l4l4kEjI @l4l4jIn@ @l4l4n@y5,, l4l4y5l4l5o /ul4oT= l4v A_l4 _ 3l44!3Cl4w!,/CQ,ASP@@P,@TUA"((!++++++Rt^mBЩ9Ϙ0ax@' | 2 lr zm,l5 l4 l4 l4 l4 l4 l4 l4 kF l4 W j l4  7hl4 xMal4 !~+ AVFIMlY, MIn all major ...     Igimp-text-layer-(text "In all major\neBook formats") (font "SolexBlack") (font-size 35.000000) (font-size-unit pixels) (hinting yes) (antialias yes) (language "en-us") (base-direction ltr) (color (color-rgb 1.000000 0.000000 0.000000)) (justify center) (line-spacing -13.000000) (box-mode dynamic) (box-unit pixels) MnzM >4%((8888888mBЩ9Uɧax@| r Ğm,xl5 l4 wl4 [l4 Ll4 Ԗl4 Hl4 vl4  l4 ll4 -l4 l4  7JR5%((533m2 K1 0Ύ)0W"-ěMze9<9< Py? cN%)h|lh|< @ 뀀@ܬG @ @| @_,, y (( (( .l4l4.l4l4.l4l4.l4l4.l4l4.l4l4(kl4l4m98ˌeѶQUɧkJl4l4N=bl4l4  }l4l4| l4l4r9Ğl4l4mVXCxl4l4l=Dl4l4l<Dwl4l4l<D[l4l4l<DL l4l4l<DԖl4l4l<DHl4l4l<Dvl4l4l<D l4l4l<Dll4l4l<D-l4l4l<DY!l4l4l<D Y6JR5((#"CPO=lSDl7DlDlž:l l!l}|"9<mD\ԦlDg"l^Dl)D|lln#$+334A4˴ g||e777m98ˌeѶQUɧkN耀h"Կj.N=bJ}c nd| }dr9Ğ0dmVXCxG;-l=DFqF9l<Dw,ll<D[l<DLtl<DԖgl<DHJerl<Dv @@@o /uݰ=  7AFA 3 47473Cژ1,/,/ASP@@TUA@TUA@@@l47Bl4FlAFl4ld"l4l 47l4l ,/l4+@TUA333l<D 9+dY-@l<Dlt Ql<D- t l<DGtSl<D Y!fG:JR5 '*8NWO<_&/}cover (paperback)     4}Pnz}|Cm^f (sk`>]uhT`ā9Þ].<v4לyɆ`90cΞӋxCτxԹA9d;#뗢p*wAφkk'9b땠o⼀$v1߮RM9l7땠_۸#s!4Pg 7G摜8 GvUWv9(ry2Jn;eg'`{}{[%asIOsRS:gv:$ 1T^*83 3(U"57 ,9ݘ)(á, W#(f9Gx>>'oS[n!2mvEEs{D3u,-ewDWVÈW?"E۩5h^0zፉ^3\ޫG_usoZxMSO\6妫eEDgq%KS+xPSeCI̼Tfo$L˺?)x9~p4V (|vZ٬gmRStr*'8?TɧPi`aä2ۄ+`!2Hg _rz?+n4@f N\QfR        2 / -+   *   )    & *378870 %/CRUPE<61- $,PnqfVG:4.)# ##Hv}iTE:1+$  "+dhRC81)  # +mQB80* " -srYD92+# "&iz_J;3+$ ! RgQA5-% !2ŹsZG:0(!    ]ƫdO@6+# -ͽuZG;2(  JдkRA6.$  (sk`>]uhT`ā9Þ].<v4לyɆ`90cΞӋxCτxԹA9d;#뗢p*wAφkk'9b땠o⼀$v1߮RM9l7땠_۸#s!4Pg 7G摜8 GvUWv9(ry2Jn;eg'`{}{[%asIOsRS:gv:$ 1T^*83 3(U"57 ,9ݘ)(á, W#(f9Gx>>'oS[n!2mvEEs{D3u,-ewDWVÈW?"E۩5h^0zፉ^3\ޫG_usoZxMSO\6妫eEDgq%KS+xPSeCI̼Tfo$L˺?)x9~p4V (|vZ٬gmRStr*'8?TɧPi`aä2ۄ+`!2Hg _rz?+n4@f N\QfR        2 /- +   )  ( "! &&3AHKLJ@ % 6Nbjh\QIC< $2X}~o_NE>7/  #)Om\N@80%  "1klZMA5+#1jYKA8) " 3xr[MC9. ",nxcPD:/" !#W˳jWH<1& !8ĥr_O@5*   %bϺ}gVI:/#  2ɯt_OB5)   OkXI>0$  (sk`>]uhT`ā9Þ].<v4לyɆ`90cΞӋxCτxԹA9d;#뗢p*wAφkk'9b땠o⼀$v1߮RM9l7땠_۸#s!4Pg 7G摜8 GvUWv9(ry2Jn;eg'`{}{[%asIOsRS:gv:$ 1T^*83 3(U"57 ,9ݘ)(á, W#(f9Gx>>'oS[n!2mvEEs{D3u,-ewDWVÈW?"E۩5h^0zፉ^3\ޫG_usoZxMSO\6妫eEDgq%KS+xPSeCI̼Tfo$L˺?)x9~p4V (|vZ٬gmRStr*'8?TɧPi`aä2ۄ+`!2Hg _rz?+n4@f N\QfR         1 "(,/1344.#+10-.012457,)++(%"!!"#$%&(+ *.)$!),-*' '(0+(&#'.5;:& ..).8K`us#$&&$%#/01Igwl3 &((&$ '12Dm}odT,#%2;aufWA&" #1B{õt`L4   ! 0BŸtdI-   "-EȻwgR/    " (>{̾ziU> !6eõmXD%  ! .Iʺt`L3   9oiT?"  (Dϼw_J2 .\ʷnU@%Z8*_66 Wr4 AS  $#  #!izCZp)tfd2M> ,Zcxk];reީ?sCݎ8<폧e@tݰdY`Xe?qqY벙t٪e?n훚v_𸞌kH׋37$YIsXbn6^wC6~v8 rQMsL@;A7҈7T#8/- , )/ /$~q]'0D@ qޥ#   \1J    ND&D%^zK@޵RlĨ#Z~~[*ZO_pfDd&5q޳=-ʃ̉cMUDT&Z]ݸڼnfԃD&md ݔU왜nݕ~D&nӺK b^A왜nRGaD&buv3HA,ﲶgL LD'Lī?1v+zx_ZLIDh+Ԇy#6}n#c6_=*uw1z}-+x(%ttn      8 5 1 0 .  -   +  * "#"  ) !#%'&!!(  !%).(#!'  #+0/%%!& %+14,% & "'-37- !&% #(.48,!#&$ !$*088+!% # !'-5;7'!&# #)19>5#$!" &.4 ,Zcxk];reީ?sCݎ8<폧e@tݰdY`Xe?qqY벙t٪e?n훚v_𸞌kH׋37$YIsXbn6^wC6~v8 rQMsL@;A7҈7T#8/- , )/ /$~q]'0D@ qޥ#   \1J    ND&D%^zK@޵RlĨ#Z~~[*ZO_pfDd&5q޳=-ʃ̉cMUDT&Z]ݸڼnfԃD&md ݔU왜nݕ~D&nӺK b^A왜nRGaD&buv3HA,ﲶgL LD'Lī?1v+zx_ZLIDh+Ԇy#6}n#c6_=*uw1z}-+x(%ttn      8 4  1 0 .  $!- %( +!%#$+%*%+..-)##+*)!'+.143(#,+( $(,17=6(#/,' !'*09@?1#(1,& %(19BF=*)1+&  $,3GL;,/2$ %,09ALL9,2*# "*,3 ,Zcxk];reީ?sCݎ8<폧e@tݰdY`Xe?qqY벙t٪e?n훚v_𸞌kH׋37$YIsXbn6^wC6~v8 rQMsL@;A7҈7T#8/- , )/ /$~q]'0D@ qޥ#   \1J    ND&D%^zK@޵RlĨ#Z~~[*ZO_pfDd&5q޳=-ʃ̉cMUDT&Z]ݸڼnfԃD&md ݔU왜nݕ~D&nӺK b^A왜nRGaD&buv3HA,ﲶgL LD'Lī?1v+zx_ZLIDh+Ԇy#6}n#c6_=*uw1z}-+x(%ttn      71)"4848:4,1)(),0482&0 ")0587* ."*18?;" ,#-5CH5+&;B>6+$#)3@MB!*% +AMQSQJ?2+1>LK$ ( -;DMSY^[G42>NM( '!0@HOWbl`F8?TO) ' -FWO$& (9BHYhw}jIIXL%  *9@O]kzkMOZB % ,:HTao~iMT[($ 0BNWetcMZL# !>JO]kZO[7 # 0?HSbtxOVP!" "5AKZl}dKV8! *;ERetKRJ!@yʪbK=3*   ãZE8.%  /ྜྷyR>2)! 5བpH8-$ +Ẍb>1'߰zP4) ՜b>+ wF/2T2# 4B%6'  U) qu?&"(   Gwa8PgXcw`8  9O@*ThJ97?T8H@0:Xu|usx} "DMl|]% &6@A<2$TK4RU1     Rr!9N%  \u'sN%   _OK{j:   8g~ǵW-PbgqȥI$:OPjtȒ6  G0;n"@(+~λI    1:&qҶ8  !C*'X¡j/    :B%!#9}S. ' ;:''"$z|NA0  ) * $*$F1>5!  )  94>K +A;#) UrU9FB% )  SeQL) )I]Q- ( _ȶvZP0   ( TxVLO3!  $6QecR>BL6"     0`f`LBE7#  RhegC4#  + /-&  % *($"`R81,%   (2$!&'"AI;1,&"  8P;-(!&'#240+&%" [lB3,#)  "$&'(('##! ki0#'! !.CI90((' (hU " % -XS?3$30!-jO ) 1LH9+E7(1nQ *4B86T<,2rT  +&534?/#2rU  +!3:4(!2qT  +"FPZrdSF2.1-%=FYlw~kXI837- %\?,!" .D`H.!$.CmS1!$. 0]8% ". ?us:1.)(+4{ӹ{cQC8) "ͳs\K>2$2ʮjTC6+ 9ȩ`K"   T*@a1 b%,zža1 #l\VL&   ?zm< ^ylwͳ]0 Baeny΢F!  #V>Jz-  I26ÕV'    7E0~E'   $N5 3eʧv=&  & AP1&,/Bb<' .CI43-(\TA* 0 $6*/6"(M?TH,0!E@GQ%9XO. 0^}ZG^X2# 1  Wujc7% 1 LϏvi<' 0  aÿrh@)  /  WicgD+  +=^wyeOXdH.    9nwq^U\J/( ZwvvVE/ 3% F\eX?. A* AmĘT;- 3/1$&h{D9+/: mU96) )) m?:5' ) #+N?<3'  +"21-$)qgKA;2*$   /=-!)/0)R_OB:3.($ @^J82+02 -AEA:31-)% e}S?6&-5  &-044563//,& "##xy=,0 !  +]`PC;0#Ad)' +)B_bWJ>2Qh- (+'0DP[djo]T>:=-%.KThzxdXGBE-.lN7+,))*.UsZ:'(*,/.T΃h?((*,0.$*G#4aȠbB' *G#4 U๭kF)  *F"4iϲqI+ +E!4_wM.  &?%1Ly}R2 'PT5 *@% "s|T5 K< c׺qR5 \A$*gڷjP3 KK<-% =ҝpfM2/L%(H %,ȶzecJ/   "@"#8 "5Ǒkg`F.   ;!04)++ Dpl[G7*! >3(IKC7 BujYKA8."  BZG5?IJ>-}th\RHA7'&# TrWOFORIitpf\WQIA552.) |}cUBMY -AOU[\]^YTSOE9<>"-`GL067! !.8Jd~~r`I_^; ;A0<$ (VxXxrP& B<+8(\d_5E?+8*Dhrg>EC-:*`wiV@XE/;!+(FgmXrK3? $++BMeĴvv`[[, 6Kp{pjl-IлtXGJFFJ.'՝[FHJNU.%᱕aGIKOV._ٕlOFGHJN.Nݠqd^XX[d '-4-!  #(-;?/23  !)7Zx\DJ  '8MrMS #/@LiVT/   (2BLe[Q:   ;> #+2;GebQ@  $% 0[r $*2:Gb~lRE#Oqo\Yx` ")3=K_{pSHt{f.  ")4>L\zsTJsI25DJ81@ &-5@MZ{pTG#%(/7AL\gRB   &09CN`ZO6   #,6BOgPP' "'.8FesJN $(.38Su\FE    &+158OaJG9  #).38!  #(/38>R]??0 !  %+16EC348#  %*04:A@2.:#$   &-28=A7,41 $  (/5;AA2/5% !+18>E>/4) & &/5;AF412&  !(18?FD,5"'  #*3;CL;40' %,6>KO7< ( &,6ATM=7)  %*8IXGG#)  $-AW\HE *   $0EaaL.* %1Ii`H+$,7QmW8 +   ,9KsoM)+   /B]vD+)  ,Ecd<+)1 -KnB/ ,0B)  2Tyu-&,"<(  !;]e)",4%  ,EdW.#,8-$5JgW4%,B7 *9LiR6%,F: *8MlJ6#,F:'4Ge?5 ,G<$-:Nr26, IA'2=Sa.9-"LH''8EMUA=1 -"LK1+3BIHD@8-=Thx{woU;:1.BVfyzjQ=?0*;AQhni]WA 0=\b}u0Cjnöc00DJ`~tfT+0BNUiwtff[#0 %*4K\|]d  !)06=DMhnZY   $+39AGMev][H '.6=EKRpnUY5  #+29AIO[xaSQ!   '.5=FMUirPS> ! "*29BJQ]sZJN'!  '/5" #.4;BJT\WBEJ"#  (18?GOXUB>N. $ !*3;CLTXI:EB$ #)5>GQXXB>G%% %,9BLU]R>F7 &  (2=GQY_EAB& ",5BLU_[;G. ' %08FQZdNF@'  '1:IUbeIP*( %(3;HVkaQH) '19J`o[\,)" &0=Woq\X *  '0A\xv`:*'1B`t[+ .:JhjG+ $;Lb`4+(# #@YvV%+$3! "<\|uL+4># $;bQ=,>S1 &Bm;2 ,,N3 +Nvu6-,C1 ":\}h=.,H: 1HbhD0,#VF8KdbG0,)ZI 8Ke[H.,)[I 5E^|OG),)[M !0HT`m~_kf  ,8BO_x%  '6E[}ʲ9 +@ToǿS   8M`wĜg  #=SfwŠu  ;2 #!  %4ES`l|rh ! +=MZgs~wC "  %2HUan{le" />Q]ivmx|7#   (8HXeqmkL$  +;J]kyzdxo$  0>J`pnlx=%  #5AOfwiw\&  )8GZnrpo.&  ,;N`ugxJ&  ,@Td|~xj#'$).EXhxC (,7 0FZjp( ".).DYeC) ),,CWm*#)% /FWuX*%') 1FXv,+!(( 7Sij+.-?jM + <2>pʰ8+7M1$=iŞu'+V^6-@g|b+e{G3EoeU,J}O4M—_N,3qS=gŎiM ,1t]$'W~ȎtM ,>n,5d̊wK ,Hs/8ë́xH ,It0 7_zzxB,Ix6&:Ymix6,MC1C^ugv',NTG[{|`-Nicsx--sw|n+.󂛢rk,/\sz|]0tј0|0`}w> 0s~90@0 :֓a\XLHP^.n鳋ua]ft.|ΖpaUHEJS. G. =~JB?87G  5  --,-.-. 60 DܞmhdYW]j.%qnu. )ՠ|maVRV`. BǃOFC?@EQ. Mzwrfep.(뿠yu~. 'Җqe[NIKS. CˊWNKECIW/Qۢwusiit. 2¦{v}.ˌi]RHGLY.Xωa^ULJN].'vܣ{poy.U•ufWPRZg/ +8XP>)1#'( 24!53!  4 89 9;6:    +.8 )(  & 0& *( '0&  EK(\;%&(THH+'BC+L:0&"=KN6-%6HJ8.,( :?aMF=QC2^KJC38DIMJ6OCA?H# DS[A:RU=URQFD?GI49X6CH^F/Y,9JQIHMP;MDEHP! BCURUdkR]TQLLJOT /#... 35()30*%$1+ % /JQZ^MLD:51.??   3DNUK3#") 8KSXR1 &$> #5;-CVb`^2$7,,/$=5*O^ =J_DK]g`c0'MFII6F$ ADEAOE AXgAS_e\b,%R\\PD@A!)!#+,4% (-.+   !%'# &wO !".873;;C]:*,N7- iWidkh0\U[pWoxu|ztxxqjx{ dLZexg*.tHbwfJryoYoy 0"*+0D6=74H4H"FD}hM;7G<%;>G  7"   - .-,--.6/\紋~}. >Ѹ.B⸚yvx.N١ujecdhr.i켘. Dй.?߯zpmmt.Qܦwliggly.p繖.Qӿ. 1ڦyojilw.!rި{sru.A滢.$eֲuqrx. %2EyweC" #0:6447<  " .LZaceK<71,*4: )OkxwM4-'!!'3)  )So{wO4/("#(4&'"'1PgkxaK47/+,)2$&"1; &/<9L^_lRC1<7660;$)*+*1,)7@4EVYdN=,81<$%**"(%.65@QU^K8(5//66=$  $8JQVJ2"'!#&.% 1AIMF.   +8?B;,%&wO !" 7EHHPKLb?/0R=4 iWidkh0\U[pXuy|{tl{~ dLZexg*.tHbwfOy}q\q{ 0"*+0D6=74H5J(MLoS?;I>(=@J  #?+  -  .  -,--.6msyM 0􀃅oV00]ZZelgVE/0RV]rn-0Q 0􏔓~aG$0PSVbhaSF10Z]d{y70􏚣K 0􋎋jQ10ZYXcjdRC20`fn@ 0I 0kpjjaO<*0 1  3 5 6,96  >VN     /"  66   ! ?qT'PW1?UYSU+JXUSO%GN6EUPNo$PI/PM`YASA4O6 WZAXujp{|Cq`yxa kPtSsru}fvpymn 9&Wyt@puAPE9DLGSAC:UF-8FETV$SJCHE%#    #   #" %$%)/^>%!(Z?C) !]?bafkhqlxfdZZXcfi^mj-!VQdeon{uk~ivLA\wom}e^0!) )?9EF7<14K/77&D15A?5,'!  "///// 1 7xU0􍐒{^40igiv~zeP60]blx30¼X0lN'0\_dsztdQ80fjs> 0ǼS 0y\80egiv~ycM80ls|H 0P 0u{uvvn[E/0$$! 1 3  5 6 ,97!+'  #D9+),*+)*$+*)'#'"*('E7($''/,!*!( 01K%/MJ;FOIMN4KMMHN8KJ=LDH?S="BI8Y/;EHHG;H0 >1P?0?VODND8BG?L?A9NDUL>R2@;I8bG$[FLGG>TBAI1;HCPY/H+:TE#8,-++'1(%&"")+)$!$!# $ #&('(+1`>%!(Z?C) !_@ccilirlxfdZZXcfi^mj-!WQegqn|vl~ivLA\wom}e^0!* )@:FG8<14K/77&D15A?5,'!  "// ///1 7ŵl0µr? 0􈉐kF0}D 0̶m0í_00zmI0􅌘P 0ǫe0wH0􂈑hJ0􌓠Ľ^0;c0w]>!0.:;5(1!$ 34+$5  +76   -'  +"  ('3$54',2/01!.00-1#0/'0+-(4'+.$7&+-.-%. 9)/:1)4<8-1+#),'/')$1+50'3($-#'65+> "/43*#0+ <4.5:82:7!" <91263-1+?<4365//'&;94465./&&@;=?@@547- %$ !!*/ #C=@@?>7:;-2)18 /(=- $A::785<3/2 %-+28-%5+#2-+*+)+'"  ##! $! #-//016b?%!(Z?C) !d!FhhlpltlxfdZZXcfi^mj-![!Uhjtqxm~ivLA\wom}e^0!.-C>JJ;@44K/77&D15A?5,'!  "..../1 7@????<<<<>`0Xborder      )XMAMYeXqw  ) 9 I Y i y           ! 1 AMYiy!1AQaq} ]q==============================================================/==============================================================================================================================================================================================================================================================================================================================================1,dK2%cover (kindle)      8[gt/O`wH;{xywwyyxyustuuvtsqq~{xvvuuvvsrs srqoo~zvsrrqqpqqrrqrrqppoponnmnq|}yurnkkjiijkjihghxwqkhecbba`aabccdccddccbaa`a`soida_^]]^__`__`__^^]\Fnmic_]\\[Z[[\]]\]]\[\\[[qihd`]\[[Z[ \[\[Zzgfb_]\[[Z[\ \ [Zqgfb_\\[[Z[\]]\[\[[ZY4ceb_]\ZZ[\[ZZYZYX)cea^]\[ZZ[]accdcbba4cd`^\\[ZZ[YP?8::;; :Bab`][[Z[\V= -Haa`]ZZ[[ZUB-Iaa^\ZYZZYUC-Laa^\ZYZZYXUC-?`a^\ZZYZYXXTC  \_][ZYYXWSB WXVTTUVWWVWSB,Ηn7!,0MVVUUVSB @٪>JTPUVUUVRB HܔQGVWUTTURA Fښ!Nࡌ@WXVTTSTTUTPA:ԲO,^Ķ4WLVVUTTSSTTP@۳Ѻ.SUUTSSTP@YZscSUUTSRRSO@  [UTTSRQQRRQRRSO@ TUUTSRRQPQQRO?-VUUTSRRQPQN?-\UTSRRQQPM?-[UTSRQQPPOPM?-[UTSQQPOPM?-[UTRQQPONNOPL?-[UTRQQONOL>-[UTRQQPNNOL>-[UTRPPONMMNNOL>-`UTRQONNMMNOL>-ETTRQONNMMNOL>-PSQPONNMMNOL>-PRQONMMNOL>-PRPNMMNK>-PQPNMMNK=-%OQONMLLMNK=-$OQOMMLKLLMMNOL>-*OPNMLKKLLMNNOL>6NONMKJJKLMNNL>+MNMLKJJKLMNNOL>JNMLKJKKMNNOL>-KMMLKKMNNK= PLLMLKKMNNJ< ;{xyyxvuutuvspqqstrrqr{xuvvutrs sqooqop}ytsrqppopqqppononmllmqqvywtpmkkjihhijjihgfgupkgdbba`__``abbcbbccbba``_`_rqnhc`^]\\[[\]^^_^^__^]]\[lkgb^\[[ZYZZ[\\[\\[Z[[ZZxigc_\[ZZYZ [ ZY|gea^\[ZZYZ[ [ ZYzfea^[[ZZYZ[\\[ZYXJT\TTUQA HܔQZUTTSSTPA Fښ!NࡌRUUTSSRSSTSPA:ԲO,^Ķ4WXUUSSRSO@۳Ѻ.\TTSRRSO@YZsc[UTTRQRRQQN@  [UTSRQPQQPQQN@ [UTSRQPPM?-[UTSRQPPM?-]UTRQQPPOL?-dTSQPPONOL?-dTSQPPONOL>-dTSQPPONMMNOK=-fTSQPPNMNK=-mSRQPPOMMNK=-mSRPPONMLLMMNK=-mSRPOOMMLLMK=-pSRPONMMLLMNK=-iSRONNMMLLMNK=-+PQONMLLMJ=-'NPOMLLMJ=-.NONMLLMJ=-.NONMLKKLMJ=-6NNMMLKJKKLLMMJ=-7NNMLKJJKKLMMJ=7NNLKKIIJKLMMK>6NNLKJIIJKLMMK>6NNMKJIJJLMMK>KLLKJJLMMJ= JLLKJJLMMJ< ;󍈆}|}{{ywwx||zxyus|~||{zy|zyyxvvyxwvvtr{xwvvutuuvvutuuttsrqtz~}zvsqpoonnmnooponoonnmmllyzzvqmjhhgffghhihhiihhgfeffwtnifdcbbaabbdeededccbatrnhdbaa`abbabba`aa``knnieba``_` a `_Djlgdba``_`aaba `_Iklgdba``_`abbccbba``_^Qjkgdba__`a`_^ ^]^]]Xjjgdba`__`bfiihiihhgh g_iifcaa`__`]TC;==>>=> =fhhfc``_`a[@ -mhgeb`_``_ZF-tgfca`^__``__ZF-{gfca_^^_`_^^ZF-kffca__^^_^]]YF /cec`_^^]\XF JT&Y[[ZZ[WE HܔQ#Y[[ZYYZZ[WE Fښ!NࡌZ\[YYXYYZYUE:ԲO,^Ķ4WY\ZYYXXYYUD۳Ѻ.G[\YXXWXXYUDYZscg]\ZXWWTD  .YZYXWVWWVWWSC i\[ZXWVVWRB-T[[YXWVVRB-8YZXWWVVUVRB-v][YWVVUUTUQB-WXVTSRRSTQB-FWWUSRRSPA-IVWUSRRSOA-JVVUSRQQRSPB-QUVTSRQPQQRRSTPB-YUUTRQPOPQRSSTQA\UTSRPOOPQRSSTPA[UTRQPOPQQRSSTPA[UTRQPOPQRSSTPAbTSRQPPRSSPA eTSRQPPQRSSPA ]  CRTSSTSTS[w[!,!@!E!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!D!?qrqmqsrnnonjkjikkjkifgghihdcdeddeebaab^]^^oopolnpollihihihffecbbccb`_``_`_]\\mlkjihhggffgfeefgfeedcbba`_`_^]]\[Zggffedcbba`__^__``a`^^__^]]^^]\[ZYXW`_^]\\_aaba``bedb`^egc^ZZYXWXWWVUT\]\\[ZYY]kvvwtrrttuwzuqqnz}vi[VWVVUTSRQZYXWa}~x_UUTSSTTSRQRRQQPOOZYYXYYXWW]o|wuqnkijknngZTTUTTSRQPQPPOZYYXYXWWXZ`kpqqrk`YXXWXVUTSSTTSRQPOYXXWVWVWZcge^YWVUUTUTTSTTSQQRSSRQPONXWW VWXYYWWVUUTSRQQRQPOPOONMaa`_``_ `_^^]]\[ZYXYYXXWXWWVU::98765655432    )9v BO   Lͥb 6h=    Ǝ^WUM>cM3hPNjP3hyz&IzwK_]Xatb36a0,vo7RhywIt}*ɣǤt2Nϕ]SZ퐐ƌ||uɁاB Ɩ䝕ɽϣ NxQھyɓ珏ˎįжմh$ƍ脇oPޛDIڴ|Ą䏏ˎ籅sGYrfoԶM S˔c[丫tԔâŌwטmDžLŪ9Gt+A˗VR~wrnɶX_ŽZi O[X&4/ 0: DNL: C62D6cF;+0688:J[< C[F.;'N\>   kj   *Xob(   593./:.53 (> (I0@(90^pdX;a0G= ;<.o3:ʁPU3 ?+Ȍy-$;+/tYIWkpj4:tƷQN`uݱtKg=Gvo̡_2kQΰ䉞۰iGbHˍ|Ubִd mAϑ痢ۓ2}ƵťƞÄƻIzyč}Yd՘k9 rD͏疡椌R깖]Ǣ(hÁHͨՏyטFvחo q8ĤcbNyRnUE][p.PW^OGOMO8rvH,  &09CMH:1:5! ,so]N=&   $/5APUH5;8.uraQ@' $/9ER[K<77 &[ïyeTC0'3=IW\J<<% HлmZH6   -7@N_[J98 "pɫwcP?+ &19FVd[=@( D۾m[H6  (3>M^cS=3o״{eR@+!.8FUbc?9*"έs]J6  (4@L\hK>.0ƦiS@+  "/9DSb[A.$:Þz^H4   *3=HUaC/0 *ᾑlP9!   #+4>LjbZT ְ|Y<$ '4F_h. ?qnmnnkijjkjigkljgjhgghihddeedbaaefdaabb^`b^^\ZZolljiihgfiihfhgf feccb`_`bcb__`]^_\\[YYlkkjihgffeddeddcbaa``_^]]^^]\[ZZYWWfeedcbaa`_^^]^__^]]^^]\\]]\[Z[ZZYXYXWWXWVUV__^]\[[^aa`__`__adca_]cfb\YYXWVWVVUTUSRRS[[ZY\kvuvroprrsuytpnkvztgZUVVUUTUTTSRQPYXWV_|z{~u]TTSRRSSRQPNYXXWXXWWVV[l|xsqnlighilleYSSTSSRQPONMYXXWXWVVWX^hmnoph]WWXWVUVWVUTSRRSSRQPONMXWVUVX`db\WVUUTSSRSRPPQRRQPONMWVV UVWWVUTTSRRQPPQPONML` _`__`__^]]\[[\\[ZZYXX WVU9877676566556554432    )9v BO   Lͥb 6h=    Ǝ^WUM>cM3hPNjP3hyz&IzwK_]Xatb36a0,vo7RhywIt}*ɣǤt2Nϕ]SZ퐐ƌ||uɁاB Ɩ䝕ɽϣ NxQھyɓ珏ˎįжմh$ƍ脇oPޛDIڴ|Ą䏏ˎ籅sGYrfoԶM S˔c[丫tԔâŌwטmDžLŪ9Gt+A˗VR~wrnɶX_ŽZi O[X&4/ 0: DNL: C62D6cF;+0688:J[< C[F.;'N\>   kj   *Xob(   593./:.53 (> (I0@(90^pdX;a0G= ;<.o3:ʁPU3 ?+Ȍy-$;+/tYIWkpj4:tƷQN`uݱtKg=Gvo̡_2kQΰ䉞۰iGbHˍ|Ubִd mAϑ痢ۓ2}ƵťƞÄƻIzyč}Yd՘k9 rD͏疡椌R깖]Ǣ(hÁHͨՏyטFvחo q8ĤcbNyRnUE][p.PW^OGOMO8rvH,  &09CMH:1:5! ,so]N=&   $/5APUH5;8.uraQ@' $/9ER[K<77 &[ïyeTC0'3=IW\J<<% HлmZH6   -7@N_[J98 "pɫwcP?+ &19FVd[=@( D۾m[H6  (3>M^cS=3o״{eR@+!.8FUbc?9*"έs]J6  (4@L\hK>.0ƦiS@+  "/9DSb[A.$:Þz^H4   *3=HUaC/0 *ᾑlP9!   #+4>LjbZT ְ|Y<$ '4F_h. ?tuvrstrrpqrrsqnnokjjkjfihgghijs spqoonoopnlljiihfhgffrqpoonlklkjijihhihggfedcbaa``_llkjihgfeedefedcddedccba`a``_^]\edcbaabeffgfddefgjhfdcikhc`_^^]\]\\]\\[Z[ZYYa`_bnwwyurttvyzvsroy|wla\\[Z[ZZYXWVV_^]\d~|{z}vbZZYXXYYXWVUTUU_^^]^^]]\\ao|~xtspnkijkmmg]YYZYYXWVUT_^^]^]\\]_ckopqqkb]]\]\[[\\[ZZYXXYYXWVUTST^]]\]\\^dfea]\[[ZYXVVWXXWVUTS]\\ [\]\[ZZYXXWVVWVUTSRgffefeefeedccbabbaa`_^_^_^^]\[[==<;::;:: 9898876    )9v BO   Lͥb 6h=    Ǝ^WUM>cM3hPNjP3hyz&IzwK_]Xatb36a0,vo7RhywIt}*ɣǤt2Nϕ]SZ퐐ƌ||uɁاB Ɩ䝕ɽϣ NxQھyɓ珏ˎįжմh$ƍ脇oPޛDIڴ|Ą䏏ˎ籅sGYrfoԶM S˔c[丫tԔâŌwטmDžLŪ9Gt+A˗VR~wrnɶX_ŽZi O[X&4/ 0: DNL: C62D6cF;+0688:J[< C[F.;'N\>   kj   *Xob(   593./:.53 (> (I0@(90^pdX;a0G= ;<.o3:ʁPU3 ?+Ȍy-$;+/tYIWkpj4:tƷQN`uݱtKg=Gvo̡_2kQΰ䉞۰iGbHˍ|Ubִd mAϑ痢ۓ2}ƵťƞÄƻIzyč}Yd՘k9 rD͏疡椌R깖]Ǣ(hÁHͨՏyטFvחo q8ĤcbNyRnUE][p.PW^OGOMO8rvH,  &09CMH:1:5! ,so]N=&   $/5APUH5;8.uraQ@' $/9ER[K<77 &[ïyeTC0'3=IW\J<<% HлmZH6   -7@N_[J98 "pɫwcP?+ &19FVd[=@( D۾m[H6  (3>M^cS=3o״{eR@+!.8FUbc?9*"έs]J6  (4@L\hK>.0ƦiS@+  "/9DSb[A.$:Þz^H4   *3=HUaC/0 *ᾑlP9!   #+4>LjbZT ְ|Y<$ '4F_h. ?? STSTSSTSS?@][ZZ[ZWVWWVPQ\ZYYVURE8ZYXYYXXWVUVWUUTSFNNWVVUTTSRSSRRQPSRQPOOPOLPONNMNMMLLMNNLONMMLMMLKKJKLMFNMLMLKKJJIJKLMI9NMLMLKKJJIJLLH>NMMLKJIJKF9LKJJKJJIJIJF<UTSTUUNIIJIIJJIIJF<21366BIIJIIJIIJIF>0LIIJIHIHHFC9TIIHFC9TIIJIIB78SIIJIIHGA;7RHIIHGE@=7RIIHIIHGE>95QIIHIHGE@<5PHHIIHHIIHHIGF@:4OHHIIHHIHHIHF>74OHHIHHIHF>82NHHIHGIIG?81MHHIHGGHHG@:1MHHIHGGHGGA;0LHHIHHGF?90KGHHGFGFE=7/JGHHGFGFE?8.IGHHGFGGF?-IGGHHGFGG-HGGHGFG,HGGHGGFG+GGHGGFFG*FFGGFG)EFFGGFGFGG)EGFGGF(DFFGFFE'BEFFE&BEEFFEFEFE%AEEFFEFEFG%AEEFFEFG$@EEFFEFG#?EEFG#?FEFFEEF"?EDEEFE"=DDEEFE!@DDFG7DCDEEA>@CCDFG6CCDA>@DDEFG6CC@=BIJIIH5BB?=HVZXTN5BAA>=CJLKKI4BAA@==@CCDFG@YWVWWVX[WVWWSRRSTQHQXWVVWYVVSQND<XWVUUVUUTSRQXEEUTSRQRRQPPONRQPPONONMMNMNMDONMMLKJNMLLKLLKJJIJGMLKLKJJIIHJIFMLKLKJJIIHIHEMLLKJI HFBLKKJJIIJIIHIHGDUTTSSTLHHIHHIIHH@.2365AHHIHHIHHG<#0LHHIHGF=&8SHHGF=&9THHIHHGFFA88SHHIHHGFD>97RHHGFC<86QHHGHHGFD>:5QHHGHGFD<55PGGHHGGHHGGFD<54OGGHHGGHGGFE>93NGGHGGFD>92MFGGHGFGFE?:2MFGGHGFFE=61LGGHGFFED:20KGGHGGFEC:2/JFGGFEFEB=8.JFGGFEFFD;0.IFGGFEFF4-HFFGGFE,GFFGFEFE+GFFGFFEFE+FFGFFEEFE*EEFFEFE)DEEFFEFEFE)DEEFFEF(CEEFE'BDEED&ADDEEDEDD%@DDEEDED$?DDEEDEDC$?DDEEDEDB$?DDEDB">EDEEDDCB"=DCDDCB!=DCDDCB!>=<9CCD@??>8CCDEB??BBC8CCDDA>@DDCDF7CCDD@=?CCD6CBCDD@=?ABCCB6BBC@=?BCC5BB?IIJIJJIIJ=HHIIJIF>JIIJHECCDD >JIIJIFEEFE=IIJGEFHHII+IIHGHIIJKH;5naKJIHGHIIJH;GkKIHGHIIJH;AA@A@BAA@8*9A@@AB@8)yYB@@A@8,qC@@?@?8+گ}B>?@@??>??8(ش{B=??>@>8&ײuA=>?>>?@@>8&լo@<=>>?>>?@@=8)ӧl?<=>>?@@>9)ѣi?<==>>?>9%̞e?==>>=>>??=9(ǘa>=>>=>>?=9&Ĕ]>=>>?=9$пZ>=>>?=9"ͺX?=>>=>>?>9%ɴU>==>=>>?>9!ĮP>=>>=>>?>9!ʾvK=<>>?@>9$ƸpH==>?@>9 õkD=<==>??>>?@@>9"·f@<<=>?AA@AA@?9"Ŷa>=<9!⠽ȶ[<=::HidJ>9ɷX:;8KsнiF9!ʸW78=oѻW;!ɶV36R˸l?!ǴT/5oȵyE ŲP-:ðK ïK+EʽRJMLKKJJKKLLJ< HLLKJJKLJ< KLLKJJKKLMJ< ILLKJJKKLI< ILLKJJKLKKI<ILLKJJKLKLLI<HLLKKJJKLI<NKKJIJIJKKJKLI<RKKJHHIIJKI<.SKKIHGHIIJH<7^KJHGGHHIHJJG;N-HIHGFGHHIJG;5n FHHGFGHHIG;GkFHHGFGHHIF;8.?BA@??@@A@AA>8.>A@@??@@A@@A>8.>A@@?@@>8.=@@?@?A@@>8*:??>=>??@>8)cN?>==>??@>8,z^?==>?=8+}e?==>=>??>8(b?==>??=8&[><==>?>=8&S<;<==<=>>=8)zO<;<<=>=8)uL<;<<=>=8%oI;;<=<9(jE;;<=<9&rfC;<<=<9$_?;;<<=><9"[=:;<<=<9%󣬰|W<:;<<=<9!𦬱uQ9:;<<;<<=<9!lJ5:;<<=><9$dE4:;;<<==><9 }aB1:;;<=>=9"񋛤_=.9;;<=>>?=9"萜\9,9::99=BED?==8!pV5+887@XwmTC<8fT2)65@\wU@8!⒜U2'46UlG8!⚤T0#1AimM8!⡨~P- /OslO8 ၤyM*0YykQ: ᘦuI&5`jT=dTSRQQPPQRROA dTSRQPPQRRN@ ]UTRPPQQPPQRRSOA _UTRQPQQPPQRRO@ LTTRQPPQPPRN@PRPPQRN@PRPPQRN@ OQPOOPOPQQPQRO@'OPPNNOOPQN?..NONMMNOOPL?76MNNMMNNOPM?N7MNNMMNMNPM?5n6MNNLLMNNMNOM?Gk8MNNMLMMNOL?D#9MNMMLMNNK>DA+(9MNMMLKKLMNNJ>#ZD:/ALMMLLJKLMMJ>!N@@.ILLKJJKI=6<ILLKKJKH=.bILLKKJKH=nILLKJJH<nILLJIIG<"xILLJIIHHF< ,HLLJIHGHHF< MLLIHHGHHF< QKKIHHGGHE=GJIIHGFGGHE<-9IIHGFFGHGD;-JHGFFGD;-GIGFFEFFD;-FGFFEFFEFFC;-EGFEDDEEFEFFC;-FGFEDDEEFEEFC;-EGFEEDEEC;.EFEDDEDFFEC;*AFEDDEC;)q_PEDDEC;,r\DCCDCCDEEC;+VbDBCCBCDDB;(_DBBCDDB;&}XBABBCDDB;&nuPA@ABBABCCB<)mKAABCB<)gHAABAABBCB;%aE@AABA;(~[A@@AAB@;&􄓙xV>?@AABA;$rR=@AABCA<"qlO<@@AABAABBA<%󌕙~fK:?@AABA<!𐖛y`E7?@AA@AABA<!qX?5?@AABCA<$xjR<4?@@AABBCA< wuiP92?@@ABCB<"xyoQ6/?@@ABCDDA;"xoL3.>@@?>@DHGCBCA;![|oG/->>]eG9!⌓jB'!1FddF7 Zf?$1JhcF8 გ{a%(&V&$']((P))U)>*}*Z,  , b- "- ?- a. !. 1. E. ^. {/ŔbA& *Pbvzc 2PsM% ! 0CUfws[ TpPjV(      !.?Sh{kK GR˰t3    #-;L_tg9 PMƢe,   &2;EPaf& ͑M    )6AKU`zwo`~8   #.;FQ[fsbP c&     (4@LWcp|pW6hE     .;FR\jymhL\ʻl<      &4@LXcq{]Y>S·\8 *"  .;FQ]mrf_H$9zW9"  0'  (6BLXeoiU\3 "s}X[>$ 2( #0=IS_leXRG<\BOeE' 2(  (5BO[fiULVo[nJ* 2(  +6ETakbVK; Ӭ{yQ. 2(  .;KZgnZVEőW3 2( #2BRallVM4Ͽ{Z7  /('8GXhne\;`tdu]<  *;L]os`V(5vto\> "  ! *j~<!bu\MB8.' 2RK<67:=/ !>hb.5QVME?8/%"!  Qx[F64@PA# #CpuK##368:>DD@8/,' eI?+$0KG( +P}j?$6ShfTBEB.do*- 5A) 9bl@LmmRXT<#gp*, `sW& M\JFCELZdwd8(<췈yqkpt&r꿔qikvnH!'Evb[X^lzrB (0~zidaiyb'qӱ_1'DۣkSKEFN[ezg9( A~oiek{Y'Z콖zzI &q䴊yh`cnuryy^='R毀vmgl{s&H߲sgcjzi@ &(IewhQ?;@JVWTOB0 -/3!   0$'  0 "  2  7%ŔbA& *Pbvzc 2PsM% ! 0CUfws[ TpPjV(      !.?Sh{kK GR˰t3    #-;L_tg9 PMƢe,   &2;EPaf& ͑M    )6AKU`zwo`~8   #.;FQ[fsbP c&     (4@LWcp|pW6hE     .;FR\jymhL\ʻl<      &4@LXcq{]Y>S·\8 *"  .;FQ]mrf_H$9zW9"  0'  (6BLXeoiU\3 "s}X[>$ 2( #0=IS_leXRG<\BOeE' 2(  (5BO[fiULVo[nJ* 2(  +6ETakbVK; Ӭ{yQ. 2(  .;KZgnZVEőW3 2( #2BRallVM4Ͽ{Z7  /('8GXhne\;`tdu]<  *;L]os`V(5vto\> "  ! *j~<!bu\MB8.' 2RK<67:=/ !>hb.5QVME?8/%"!  Qx[F64@PA# #CpuK##368:>DD@8/,' eI?+$0KG( +P}j?$6ShfTBEB.do*- 5A) 9bl@LmmRXT<#gp*, `sW& M\JFCELZdwd8(<췈yqkpt&r꿔qikvnH!'Evb[X^lzrB (0~zidaiyb'qӱ_1'DۣkSKEFN[ezg9( A~oiek{Y'Z콖zzI &q䴊yh`cnuryy^='R毀vmgl{s&H߲sgcjzi@ &(IewhQ?;@JVWTOB0 -/3!   0$'  0 "  2  7%ŔbA& *Pbvzc 2PsM% ! 0CUfws[ TpPjV(      !.?Sh{kK GR˰t3    #-;L_tg9 PMƢe,   &2;EPaf& ͑M    )6AKU`zwo`~8   #.;FQ[fsbP c&     (4@LWcp|pW6hE     .;FR\jymhL\ʻl<      &4@LXcq{]Y>S·\8 *"  .;FQ]mrf_H$9zW9"  0'  (6BLXeoiU\3 "s}X[>$ 2( #0=IS_leXRG<\BOeE' 2(  (5BO[fiULVo[nJ* 2(  +6ETakbVK; Ӭ{yQ. 2(  .;KZgnZVEőW3 2( #2BRallVM4Ͽ{Z7  /('8GXhne\;`tdu]<  *;L]os`V(5vto\> "  ! *j~<!bu\MB8.' 2RK<67:=/ !>hb.5QVME?8/%"!  Qx[F64@PA# #CpuK##368:>DD@8/,' eI?+$0KG( +P}j?$6ShfTBEB.do*- 5A) 9bl@LmmRXT<#gp*, `sW& M\JFCELZdwd8(<췈yqkpt&r꿔qikvnH!'Evb[X^lzrB (0~zidaiyb'qӱ_1'DۣkSKEFN[ezg9( A~oiek{Y'Z콖zzI &q䴊yh`cnuryy^='R毀vmgl{s&H߲sgcjzi@ &(IewhQ?;@JVWTOB0 -/3!   0$'  0 "  2  7%4BAA@==@CCEFG3AA@==@BCDEF3BAA><>ACCEG2BAA@=<=>>?@2AA><;<<==2AABCB1AABC1BAA@??0BAA?>=>>0A@AA?@ABC0A@@AA>?@BBCD/B@AA@=>@BBC/A@@A?==@BB.A?@@=?@ABCB.A?@@=>@@ABB-@>@@<=>@@B-?>?@?<<>AGECB,@>??>;;=COJEB,@>>;=BIGEC,@>>=:;=@CCBA+@>>=<::=@@AA+?>==:=@@ABB*?==:;>@@ABB*?>>=9:=@@ABB)?>>=99>=98:=>?@A)>=>>=978::;<>(><=>>;9;>==?@'=<=>>;;<>>@A'=<==;<=>>?A'>==;:;==>@A'>==:;=>>?A &==<=<9:;==>@A &=<<9;==>?? &=;;<;88:<=?>=:2s %=;;78:<=?>@TZs %<;;::78;<<>=Dem@@ %<;::978:<<=>9Ac ";::767=JD9Ah !;::9756=9Er·U !;::96579:=9Evż!<::954699<8Fy ;:9:953589;8GzŻU :99853579;8Gy:9985458:<8Euĸ ;99854689;9FvǼp;99885469:;9Gwȿ;9885469:<9Gw÷~:988469:=9FuǼ;9984469:=9EvǾ83564/159:=8Fytp I[fg^M>77:<8Hùxv4ybF99;7KĻ}!nijoG9;7LƼmʻe;94Jǿ 2ȻG7.FNƺ\8(CĻ3A@@?<ABCC1A@@?<;;<=>>1@@=;9::;;1@ @A0@@A@A0A@@?><<=>0A@@><:;;<=/@?@@>==>>?/@?@@=<>@@A.@?@@?<<>@@A.@??@><=>@@A.?>??<>?@@AA.@>??<=??@AA,?=??;<=?>?AA,?=>?>;;=@ECB@,>=>>=::==:<@GEC@*>==<9:==<<99?@A*=<<;99?@A(<;<<;88;>>?@A(<;<<;779<<=>?(<;<<;76799::'=;<<98:<;<=='<;<<:9:<<==&<;<<:9:;;<< &<;<==989::;<< &<:<<989:;;<< &<:;;:889:;;<< &<::9779:;<<  %<::9668:;==<7-L $<::9668:;<<=EHL $;::98668::<;=KO@@ $;:998668::;:=IJI #;995689:;:?AEEFGG#.CBBAA>>ADDEFG--CAA@>>ADEFGHL,BAA@=?BDEFGHI,CBAA@=>BEEFGHM,CBAA@==@DDEFG2,CAA@<<>ABCDE+BAA@<;<>>?AC+B@AA>=?ABBDE*A@AA?>?ABCDE)A@AA?>?AABCC)A@ABB>=?ABB)A?@AA>=?BBCB(A?@@?==?AABB (A??@><<>@AABB) (A??>;;=?@BBA@>@ (A??>;;=?@BBHL@ '@??>=;;=??AABKJ '@?>>=;;=??@@AGC4 &@>>:;=>?@@A? &@>>;<>?@?>>EGB %?>>;<>>@?<:GQc %?>>;:<>>@?:6M^jE $?>>;:<>>@>85Xkqie` $?=>>;:;>AA=88j|zom` $?=>>:;@KF>8=:9:?IE=9A{pj[ #?==<989=AA<:F~vogU #?==<88:=>@<;K|rnW ">==<88:<=<=<879<<<;879;<<;779<=?<;Fsxmc`N!><<;879;<<;;879;=?<<;;879<=@==Kvzla\L!><<:779<=@=<<;669<=@<;IxsdYQ;7787459<=@<:KyyiYOCADOUTNA:9;=@:;Q}}n[QKK,c}aI=;3vȿaߒön::žb ߻a6Bþ`'97&*-UǻU5M»` 0]NYU/>7Zo\ߩuL8Wſ_*`OXaWmX,g\N߬ȺdF=a»^>53Bu½YڼmżGCsZڼ»[KpWýmTk¿S{ZfþNتý\`ſIت¾^^Cڿüba?ڽȿfiȿ> ٘ƿirƽ?٭lxļC٥ľJٝQӎ¾`  獑¼~H3;@DHLPQSTUVVWV杖½ľL(',159;=>?@@?@?蠘ſX*$(-0256 6瞗Ŀžh6$)-03678878癔žýuA $'+/1356676766͑üüJ!#&*-034565665͊ùĽT%#%(,/13455665655ʄµ¼\,"$'*-/13345665545{ƾľd5!"&)+-02345545ꆈºÿlD" $)-25665459;;:9755ꃇxY) "'2;??<636>LJFE:55}p6#$18:96225;KFAB433tL*!)*(()+/2171.2+/2}辺i7!"#$%'*.1210//023倉⾺|G'!(.242324:??><644vV/+2552013:FD?=323Njc8'++)(*-01<710+/1֋nE#"(-.+*(''*02wmvO,#&*,-//047886533ڶzV3(.221.-/7EEA>632vݹ|\8'+-,*)*,0B?86./0NJ~c>$)*''%##&-0͇jE! "#&*-//001}ٲoJ%!$%&(),2>?<;520芋㾺rN'"$%&(()/?>:80/.ȆqP)"#%&'(('+)&&%+,熈pR*""$$%&''&&),.fدqU,!!#$$%&&'()*+,-n迺sW* !!"#$&''( 񃈉ڱv^3%$'()*+,,-.-.//q||wvxxyzz{{||{||{w򿺳~{ 󋆉}| 򾺳| em|| 񽺴}xx 粰yuw ۀ|ut{ ۀvrv~ ៨sG#7Zo\߇y_=&8ylE*`OXaWmX,g\NߌlP4#!>}mC>53CHLOQSTTUTTUVVpibhpxh:#%*/37:<==?>>?>rkaagp{ꗕp@""&*.1344544544njb_dmx}{uK*"'+.145656 6hgecgowzzuS0"%)-/134454d`enwxxX5 $(+.12343443]`cadku{wv]:#'*-/1233443S^ddchrw|wr^?""%(+-/11334433C`ffehpuy||y}n]B( $')+.013 3fjkhhlquxz}uy|m^H0"'+/3443347::98643gkligjmqtwy|u{m_Q>! %19==:424=IHDC843ejligiknqtvy}}}od]P)".68740039HC?@211Ygokhiilortvzsnma7#%&&')-0/5/,0)-0\qkgfhkmnrux{և|{ykI+ !"$&)-/0/.,,-.12aqjffghikoswz~|qW4! &,0211028>><:533Nypjgeghiknquy|ދ}u_<$)0220./17DB=;211plhdfjlmnptx{䐌~vbC(%((&&(+..95/.)-/wymhcfjmnnpsvz}䑌}ucI/ ',,)(&%%(.0}pkcdhlnoqsuy|~㓐~}vdN5" $(*+--.26764322sldcfkopqsuwz}䏋~vdQ8%$+00/,+-4CC?<521vtldceinoqtvvy}݈~tbS=(#(**('(*-><64-./rkfddglnruvy{}|s`UC,"'(%%#!!$+.sifccfkmrtv{~~zqaYG/ $(+-,--/00}heccfjmpsuy}䐋~xoc]K3 "$&(*0<<:941/fdbdgiloqtvz}ڀ~wne_N6  "$&&'-=<86/.-dcadghlnqtvy|}}~}ule^O8 !#%&%$(&$$#)+fdacfhjloruy{||}|sia\O:! !#%%$##$$'*,fba`adghknruy||~yoe_\Q=" !#$%%&'()*+J[_`cfgjnrvz|}}}vmd]]U?  !#$%%& Y^`cfhjmrvz|~ڀ|umd\^[I) !#$&'()+,+,,-O^`cfhjmruy}~zukaZ]grtqqsstuuvwxx S]`bfhkouy|}ysh]Y]~ _\_bfilqw}새}vncYY` YZ_bfilry~烁~qf\UYd @F\_cgntyꁄykaXU[d Y\aflsy~郄ug\USWj W[`elry~悁xnaWQQXs Y\_fmsy~woeZQNR^ X\`fnty녈~|}|wof]SNNVc ዕw_:6YvzbN;tr[88]zufZ? ᎕nV4@_zsla@F]{jO/!Jcz}uob@ |~xdG)'Tlzwp^?'97&*-UpX<%*^~~usm]> 0]NYU/>7Zo\wzeL2!/d~wuo]<*`OXaWmX,g\NzqYA,2e|yp\:>53ntux|xy{{sgZM7ޅwgO.?orvz{wwxvm_VO9y+tfR7=lms{|xtqng]YU<y|rfU?% 9gkpy{wtsj`YR:݃}thWB,#7gmpu~yutsk`YO8قyn]F2%4dnqv|xuskc[O6UudK5&1^lr{yumf^P3 U}xjR9&1^inz~xmd[M/ {ungW;'1anr|yog^M. zwha]V;(4gru}~xojaO- Wx}ui`[X<*9ltv|zuoldR. kuy|vkD-?>=;98^a`XQQTUVWX[`ekpofYbpyxxwvtuxxwxuofYK@5#!#(4=AA=869ALLIG<88_bcZRQQRSTUX\bgkic`hptvwussuvwwyvqi[PKB("!%18;:7447-"#(,/01137:;;9767k^OKMPRQRRTVY]`cdcbdeehpuvwy{xsmiihaQ@/$'/4530/19FGDA866vm_PLKNRQRSTUX\`bccbeefksuvxyzwrmjih`OA1$$*--+*,.1@?:8123j\SMKLOORUUX[]]_aabcglqtwz{zxsnjhe]LC6&&++('%$%)03nZSNKLNORTVZ]^_``behlqtwz{{xsmigc[LE9* "$(+.112455DŽXSMLMNOQRUX\^``_^_adhkorux{{xsmifbZNI=,!!#%'*+-5@A?>864URLLNNOOQSVY\_^^`bfjoqtwz{xrnjf`XPK?.!!$&'))+0@@<;22QJLNNOOQSUWZ\[\]_``djpstwz{xsoke^VOJ?/ !#$&()('*)'(',/TQKLMMNOPSTWYZ[[]`dimpstvyzwrojd[RKIA2!!#$&(('&''(+/03XQKJJLMNPRUXZ[[\]^`elpqrstwyvrmhaXOILE5!"#$&'(()++.00_NJIIKLNPRVY[[\^_``ekpqqrtvwtpke^UNIOK9 !#$&())*++DJJKLMNQTVY[]^``chmpsstutqmic\UNISTF)"#%'(*+,,../012>JJKKLNQSUY]_a_^^_bfkpttvtpkgb\TKITcpvuuvwxyy{|} AIJJLPTWZ[^aa`_^_aejnrtvxvpjea[QHIV| IGJJKLPUZ^^`cbca__`dintvxzwrke_WLEK[ EFJLMMOU[_abdeec`__cipwyz{xtme[PGDN` BK] 00 O0 j0 0 #0 D1 i1 1 %1@2n2.2O2"3[4!4 m535}666Q6o7s7g7e6%7M8c8i8f8M858~7 ]6=6$6_6065 5i5C5#44k4N4-4t3X2?2,2x2Q2/1 1 1 b1 >1  0  0 q0 b0 W0 90:6%    !)4! )0&8. 2)  :-=TX8QR@:4\iH5H6J_^M=>B(@C 5B?9JQG3DMMG/9?7KCM]%7<3GJ@9A<6%[`]fnYcaZaDgsed|fmume_ee18QZ6Xic]]_^Xab`aXbdWZXclHcjXNV^bbRZKI[MIOGIIO1FQ^ptj`XWTY[:4GXEV[TL<:AJHA?DLSRE7LE    7S_^G1'"$/+$'0/,'         >_hjG+'#+%"$#"  !&V%3OIVkz{I3LCA?;9=AB@434%3D $GJMv)$T|mkuI9jdc`[Y]bdaRU\PGBELC=rV/-% $;2=MRS2#2*/8@@:77452*#(+.1((-.* .54#   )90 .67970&(* #",6"" huNL8 $;IH@T`a\agg^MfmR2*:QQMe|bNCDSg`QI=H8Kaex^1TUg|}vygm?H[hu~}|xtiNgxzrzqI !$-8'"%.5326LkL96:*,68!*18741300+)/121+ /    '%Z VWXWXYXYZZ[Z[\[\[Z@@? >?>>?>? ?>=65 43454 434433432187 6567 65665654336545655655655432166554344545454543221056554455443434554434544543433210/54434433434343343434434322321210//54434433455334343434322332210/.7::864479::75469::9864379:986435899875336887653135655432122108BDDC?745;EEBB9547BCBB>724:BC@B:545@CA?>8339?A>A9323<@>=;6005<=75??>>;3148CA<=3233==<=:3/25==9@5132=>9883024:;9@6020;>::4-/29<303/-/0./1/2/+/+.1..-,-.-.0,,+*1,-1-/-(')+.1++*2--1,00,-/-*.*+,&310..1231/..-/1210.--.011/.--./121.,,-/11/-+*,-010-*))*,..+(%#7?A@=96459==:85335<<;:74237;<;96335;<:975326::87532379763100231/5CEA<73248BA;92123AB>941037@A;93123<>;853117?@:831219=;83/-/3>C;1:83.+-02186/.*-1/;:3-*+.1186/.*-1,22.+)+-/177.-)+1,130.)()-.9534:DD@=4224CEA>9524;FE=;5213?B?;73115;><;62108=;:61..3:<43@?;72//13?>74,.00@@;61/025CB64..0/>B<50-./.4743.-0,3864/,*,.9>1.+'$$*//*'$##&-1/,'$$+13-)&##&,0-+($""'-.($""#).+&#"! $)+&$"230/00211322479853348;:8521135753210//00/.,,-./00/-,+,--,)'$#4AGD=84116>?@AA@@??@AA?>>?>=94004B(@C 5B?9JQG3DMMG/9?7KCM]%7<3GJ@9A<6%[`]fnYcaZaDgsed|fmume_ee18QZ6Xic]]_^Xab`aXbdWZXclHcjXNV^bbRZKI[MIOGIIO1FQ^ptj`XWTY[:4GXEV[TL<:AJHA?DLSRE7LE    7S_^G1'"$/+$'0/,'         >_hjG+'#+%"$#"  !&V%3OIVkz{I3LCA?;9=AB@434%3D $GJMv)$T|mkuI9jdc`[Y]bdaRU\PGBELC=rV/-% $;2=MRS2#2*/8@@:77452*#(+.1((-.* .54#   )90 .67970&(* #",6"" huNL8 $;IH@T`a\agg^MfmR2*:QQMe|bNCDSg`QI=H8Kaex^1TUg|}vygm?H[hu~}|xtiNgxzrzqI !$-8'"%.5326LkL96:*,68!*18741300+)/121+ /    '%Z  &UTUVUVVUVWVWXYZZYZ[ [\[ZZY>>=<=<=<=>==>==>=>>=<=>>=>=>=<;;43232 23 2122121210//654543445 43443432114323433433443210/443 32323232100/.3433223323223232212110/.-32232332 232 212212210010/0/.--3223212332212 212212212110/.-,5899874236899853247996421678875324787753114566432023433210/00/.6ACCB=513:DD@@7325@BAA<5029AB?A8225?A?><6117=?=?7112;><;94..3:;53==<91/25@>:;1011;<;;81.13;<8>3/01<<7661.028:8>4.1/9<882+-07:1.1-+,-+.0,/,)-),/,,+*,++-/*+*).)+/,.+&%'),/)**)0+*0+..*+-+(,()*$0/.,,-012/-,,+-/00/,++-/0.-++-/1/-+*++-/0-+*)*+-/.+(''(*,,)&#!5=??<85347;;964224:;9842016:;8742239:99631158865310157651/..00.-4AC@<62136?>:71012?@<83//16??981/11:<:730/16=>871/0/7;972-,-1:@8/861,*+.0/53--(,0.872,)*,/.55.,(+/+00,)'),/066-,(*/+/1.,)'(++9B6.+(&&',0/+'%%(-0/+(%%*/0+'%%$&+/-(%##$)-.*'$##%*.+'#"!!%*+&$"35665332256654211366542254321121002332210//11//--,-,*)4@BA=83128BC>;4113AC?<73129DD<:3011=@=851/04:<:940/.6;984/,,18:30>=:60-.01=<63,-/0>>94/-.14B@53,,/.=@:3.+,.-3521,+.*1642-*(*,6;/,)%""(..(%" !%+/-)%""*01+'$!"$*/+)&" %+,'$" !',)$! "')$!01.-..00100/025763112699620//146310/.--..,+*+,-..-+*)*++*'%"!2?EB;72005;==>?>==>??>==<<==<;72./2:<862/./8>>:4/,*)(''/AKF93.-.08;::;<<;::;:9:993.,-0=A95.+-,9CE?3,**)(()-0,%$'++&&'((''&'('&&%&%%#%(*(.0(#"&+')/3-$#'+*)('+)('%'*,,(&%% &%$#%')*'&%$#%(*)&%%$#%))('%+**))*++))())**))*)*))(('(('())('&''())('&&'()('&%$&'(('&&%&'' ('((''&'&'&&%$$%&&'&&%$$%&'&&%$#"!!--.-,--,,--.-..-.-,+,+,,++,+*))(''xxyzyyxyyxxyzyyzyzzyzyxxwvwwv wvwvvut :6%    !)4! )0&8. 2)  :-=TX8QR@:4\iH5H6J_^M=>B(@C 5B?9JQG3DMMG/9?7KCM]%7<3GJ@9A<6%[`]fnYcaZaDgsed|fmume_ee18QZ6Xic]]_^Xab`aXbdWZXclHcjXNV^bbRZKI[MIOGIIO1FQ^ptj`XWTY[:4GXEV[TL<:AJHA?DLSRE7LE    7S_^G1'"$/+$'0/,'         >_hjG+'#+%"$#"  !&V%3OIVkz{I3LCA?;9=AB@434%3D $GJMv)$T|mkuI9jdc`[Y]bdaRU\PGBELC=rV/-% $;2=MRS2#2*/8@@:77452*#(+.1((-.* .54#   )90 .67970&(* #",6"" huNL8 $;IH@T`a\agg^MfmR2*:QQMe|bNCDSg`QI=H8Kaex^1TUg|}vygm?H[hu~}|xtiNgxzrzqI !$-8'"%.5326LkL96:*,68!*18741300+)/121+ /    '%Z YXYZYYZYYZ[\]\\]^]] ^_^\CC BABBABBAABBCBCBAB BCBAA@?99 8787788 767767654;:9:99:99:9:9989989876659:9989889889887643998 8787878788765432887878778 787787787767664322188787887767676556542210/8878767887766 7676766542110/:=>>=;978;=>>=:879<>>;976;<==<:879<==<:8669:;;98757898876534542;DGGF@968>HHED<87:DFFE@968=EFDE<879CFDC@:66@:8@@;5469CA=?6466>?>>;5368?@<@6465>?;;95357<>;A8364<8779@@><9767;?@><9778>?>=;866:<<;:766:<:9633244319EGD@:767;DC?<5467CD@=8446;CD?=6565>@=;85459@B<;5353;?><62015=A:3:840-/3529821-043:951..143:811-04/32/-+-1328800+-3.1320,+,/.9A72.+**154/+)),253.+))/45/+)()+042-(''-23.*'')/30*&%$$(-/*&#!8:;::877:987668;::977:9876654565776544543321120-,9DFEB=857:6448>A?>9533;?>=83005;<65@@=:42234@@:70244AA<942367CB981141=A>8301317:76102/69871-,-/8<20,'%%-21,)&$%(042-)&%&.56/+'%%(/40,(%$$*02*&%$#&,1-($#"!%*,'$"5531225565447:<;86557;>>:754469;85433223320//123210/..*(%#7CHF@<756:@CBBCCDDCBCCDDCBBA@<7437>A=<743472235?>73124@E<93021=FGA70..-,++-/2.((+//*))**+--++*+*)()*))&(,/+01*'&*0,-14.&%*.-,+*.-,*)*-01.*))*+*)(('(('+./,+)((*-/.*(('&)--+*(0/../0/--. ./.--,+,,+,-./.,+,,-..,++*,--,*(',,--,+**+*+,--,-,--,+,++*)*++*)*++,+))('&$"2201232332 101/01/.//..,+*~~}~}~~}|{zz{{zy zyxwv e·uB*Aƽ n¾J)8tȾ{ qR+.\ȿ@ sÿ]0&F tľ羳h;&:|¸ ssB&9mú sÿ~H'yvkhnwz70)'(&H}sihnwz6-%''(Pzpggoxy+&#'&+Xxmdfp{z$&(&0`vibdn}}-*''$8ktg`cm||2)$%$Cz䮰}qe`cmz{+!$&Q鯬ymc`dn{{ %)Z~tjb_do}})'%%,azpgb^do{{0)#%/gwnfa_eozz+"#2l诬uld`_eoyy#4n谭}sjc`^cmww"%6o{qic`_dntt'&$$6nwnhc``emqo('$$3jⲴ~tmgc`_dknk'&$#/c|smgb^^cilj'&$"+]zsmga__chhg&%#"(W{smgb__bee!#Q~zsnhb^^`cdc)'*S|~wsnhb^^`bffvuـ{vtnhc^^_biiħ}xuohc^]`dijŒ{wqjd_^`djjԖ{tlea_adkl䪉~wngaabdliyqhbacflkה|sjcbdgjm螅~ulddegij~yphfgiijO}xi_J3'4ayke S}wnjU6$,P{mgZ TtqsZ6"";u|nha@ UsrtZ8"(c|nhb UxqlW=' Qz}pha U{riZC*Dkqha U~xpgM/!Bc}tkf U{sU2"Dbzxnkd VvW2!Fh{rng XsX3!Rwwrlj X|mW3*d{vs XuhW2;t{ur[e Y~rgW1"O~xokjkf \~peW1'^veahif `|j\S4/htc]`dUc{iZR75lue^^ek e|maU97lwkb`ff ^q_T84izqicfd Kr`U61h~uleba^2wsdW60fvlc^\Z@mugY91b~ti`ZWU avf^?3[ymbZUTTWykfKAi~ti^UPRTUZۛ|pjZ[{qf\SNNOFk~skeoyncYPLKJ,XTPNKIFFRvogmwk_TLHJK/:8742/,/RӠzrhkti]SKGKN@.-,)(%!'XԠ}vjfv|qg\QIHLQA0/-+)'#+dxlekypfYNILPVI.-+*(&$.oxpif~vncVMKPW^-,+)(%$2z➚ztmfx{sk`SLMU\e-+*('%&9{upisypg\PKP[`j,*)(&$)B❚|vrnqwmcWLJR^aj*)('%#-M✘xtsp~si^SJJR]`d-+(&$"4^|wwq}}woe[QIKTadn5.'%$#;l}xyqvytmcXNGJUde4+#$$Au~yzrpwzupkaULEJWgf(###&F|~{yuno{~{vrnh_SICJYij"$#*M~~~|ywrqvxxtplf]QGBHXjk+(%$"/V~{~~}}|yxusuvvsokd[PEAHWij0'"#!6`zy|}}~|yxusttqmibXNEBIWhj) ""?i}xz|}~~{xvtrssrokf^TKDCJXij"$Fp{z|~}zvtqpqpolgaXOGCBJYjk&$##&Js{}炀|xvsrqoomjd]TKECBJYjj.&!"(Nu~~{xusrqonlhb[RICCBKYhi) !*Rv~|yutrpomjf`YPHBBCKXfg!+Tw|yvtspmjgc^WNFBBIVbc !,Su脀|ywurokhea\UMEBABJW_`%$"!,Rq|~zvtrnjgc^YQJEBABKW]\'%#!+Omvzusqmhe`[VMHDB@BJUZW%$"!'Jisz~zvtplha\XSLHDA?AHQUS%$" $Feqv}zwtpkfa\XSMHD@@BIPRR$#!#Bansy~℉zwupkea\XTNIC??AGMNL>^mqw|{xupkf`[WSOIC@?@EJKF&%$$%A_mntz||ytpkf_ZTOMHDA?@DHMHtsrrpllpux{~|wsoke_XQMLHDB@@CGNJԼijlptw{~wsokf`YSNLIDA??CIOPlhilptx|xtpkga\VQNJEA??DJQTygfjnquy|ytpkhc^ZVQLGB@AEKRUݒf`gmqsuw||wsnjgd`\YUNHB@CGKTTl\aiorsu{|uqlgcb`]ZVPICABGLRTv\\ckoruz~{upkfaa`^[WQJDADHMOR`X]elpsx}~zvpkfbaa`]XRKEAFKMNPfTX`glpv|~zuojgdcca^ZUOHCFKOPQHqr]P?3)2Uxuj`[HoqbZE2&+Fqvj`]X Ho噋ogcH1""3e}wk_[V@ HqmheG1"#Usxk`YT Hrnd]G4%Eg|zla[V IvviaYJ7'<[s|ma[V Jy|tojfaX@*:Tj}~pd^\ K{|vppoleH,;Si|sgbaf J||wuxwqdH,=Zo~wkddj J|~yo^E*Gfw}qjikj Iw{wqfVB(%Vp|tlln Irytqi^PA'3bxtjijso Kp~yrrpgZOA&Ci{qfaapp^ QrytzxrntpeVLA&"Ol{qbWXhp^ Vx{sz|zx|udQD=((Wo{}oaTS[] Zz|sy}}tcPC;),Yp||naTQU][ ]yypt|~{sdTG<*-Yo{{ncXST\Y Wvyrs||kVD;(*Wozzme_YV[\ Eo}x{}kVD<'(Unzzohb[UTUX.g}|jVG=''Tmwy|zqkc[TOOQ@^|jWI=('RmutvxqiaXPKLM T|kYIB-(MoyyumeZPIGJL$K|l\OJ74[z}si`VMFBGL[M}n_SMCIp{qg]SKD@DHJ]}pbVNKZypf[QHB?BD/ZVSPMJHGOw}peZRLWz}wndXNE?=:852.1M{Ԋsh]UNUr}wqjaXMD=;CIE21/-+)%)Q~ԉ~sjaZPPfz~|tmg^UKB=>ELR310.,+'-[}skd]SO[s{{}{skc\RH@>CJSI10.-+*'.d|tne^WRTlvy}xqh`YPF@@JRZ1/.,+)'3lztof_ZUPbpy~ume^WMC?CQYf0.-++((7r}voh`\XR\kz|tlc\TJ??HW^n/-,+*')=vxqkb]YVYizzqkbYPE=?K[`n-,,+)&-Fv|xsof^Z\Xgy|zumh_UKA;?L[_g0.+)(%2Tt}{xvuskb]_YetyxtnfaZQH@;@N_dq80)((%7^otx~|yvttmd_aY^jtqmha^XOE>:@Pbe6-%('&`z{tja^bfhkllkjhea^]ZXYXXVQKD=878BTkm)'&&'Aaw|wmd`bhlmmlkigd`^\ZYXWURMHA;77ATkm1)$%(Cau~zqgcdioonmkigd`]\[YWVUQKE>9677BTij,##)Fcr}}tiefkprpnmjgda]\[YWVTPJC<8677BTeg#+Hcpx|xngimqtrpmkheb_][YVSPNIC<7577AR`b#$,G`ktvtpmnquvtspmiea_][XTQNLHB;6567CT]\('&$,F\fpsrpnnqtvusqnjfb^][WSPLIE?:6568CS[Y*(&$*CXbkpqolmpsvvspnkgb^\ZWRNIEB<86558CPWU('%$'?U^empmjkpuvwupokgc_]YVRJFC@<85447BNQP('%#%<;74457;@HEոXVVWY]adfjotussoia\XTPJC?<:74346;BKH\USSUX\aeinrusurkc^YUQLFB>:85345;CMMkUQQRTX]bflqtsurke`YTRNIEB=:6446964;CHKMV?>ELQV]chklkhd_ZTOMLKIHD@;75;DJLN"&"<#S#o#(#6#J#a%x%-%P%v%&J&'B '!'A(h)$)5)H)Y)_)^)^)X)B)1)1("(l(a (b 'Y'F';'<'<'<'<'<'<'<'<'<'<'<'<'<'<'6')' '!'!'!'!'!' 'n'U'K 'M  𯬪}utz ܀{vw~ ܁xwz k|wy{ w W^chnsy}ywuqjbYQNQ[k W_cgmt{~xurnh`WPQWbs W`cfmu}zvsnf]TOU]h~ Badiow~{wpeYOOZ`k \pruzymb[`kn{ @GKNRVZ^bccdeefgeb]YXWTOHB>?FRf BJMORVZ`deefddefedd^YVTRLF@>CM[o CKMORV\bgihgeefddega[XVSKC>>HTcz ?LNQSY`fkkhfeeffggijda_[UJ@<@PZg R^_acgmswwtssqpprtvtqpniaWOMTbiw -0 #0 y/ c. c.???@Ɠ|ꨤ}tliiknlߢxpmmots}󖕑{sporxx˕w{~}vqpsvu}~󞝚}{|tTVZ^djpu{}ytlifecba`]XQJFGMRVU׊ZVVZ_djmsx}|{wrkhgfdd`[TMIJOV]^gUTW[_ceiovxwuoigghgb]VOJLRXad{PRSUY]`ciqttrmgegijihhe_XQLMSZac۞_[\`dgkosy{|{yuttvvuttqmgb^]`foqf@@ACHNV\bhkifb^WRONLIHHGB=87;ENQQ~HB?@CHOSY`ffd`[TQONMKJKID>:8=GQY[WA>?ADHJOV_``]XQNNONNMMJF@;9?IS_cp@>=>@CBFOX[][VOMMPPONNLHB<;>HS_bٗSMKMNORUZaegfc`__`_^]][WSONOV_lo'i''"'!'!Wb+1Nhammack-hammer     bNBN*Wz."24DTdtJLu uu,u<uLu\ulu|Q5$U++++++\ODuC/?O_Fvh6 f*i*y***R[z- ~~:b=b;[h7im5errq8Wntuts3Toyyvts2rwzyww3fy{yy{}.UNnrz~~3Zotv|y.Vsuy~zp+tp{{zzqg+tv~~vl`.s|wof[.zwpg_X)j{zskb[U,zw|ung_XU'D}xne\WW]&ui_YV[e&낊|qgcbbej)ꉎxoifefgg)ꎑ}somieda^$fyvmhfdbba`"蒔xnf`]^aceg"譪|mc^[Z^cgko i}rd][\_djnrv 憠sg_\^dlquwy|$厘wmgdejpuy|}#\olmpty{{}"}yxyxy|~~"㇑{z}"㍕{xwux}"㔚~zxxy| }|~ 㞢 㟣 㞤m첫m ᕚ ⎘ľ~:b=b;dc77ef5Vbcc7Wccba3krnic`_2ilifba`2bhhebbd.U>^bfhgefda3M^bcgjkkjdZ.leehouqjbZP+tdrnhinv{qeZPG+tTmnnmqxxsh\TKA.vrqrtwzti^SLE>.}ytvy}|ti]TKC>=)|}~{xxy{vj_UMF?<:,~}}|{yvrk`WOIC>;8'yz~}yvqjcZRJC=:9;&z{}xsld]WOF@;9;?&y~~~zrib\VMC@@AD)ꉊ}xog`YSKDBBCCD)ꋍzqke]VNIFEDBBA${~tkfaZRIDCBBA@"댍ynfa\UMD@??@BB#葘~sja]WLD><=@CDFI rxpg^XQF><=@EIILP 战~uof]TKB>>CINRSTV$哕{smbUNIGFHLPTVVWZ#镗yri\NJKPSUVVWXWX]"㒗wnd\VUVWX[ZX[]]^a"񔘖xmb^^Z]\[_bcdg"㕚{sib][ZVW[]^adhkn"㔗ypga][[YZ^adfjnqu ႀqd\[^abbdfiloruy} ㏐sib``bccegjnswz~ 񎓘ztpjddegjnu{~ |wtrqqprv|~||{} 㒗 쏎~Z:'=';k-27k035g*1228'02213(2652002A14553212P+3551,034556533!)/235663/.f<6125:><84.(+F(<9348?D?71*#+F4<=;45>;4.+'",fGF?<=?CC?;71,*&")JECB?<<<=>;50-)''$!'X5<<=@?<<:60-+(%#"!&3@?=>@@><:62-*(&$""$&37ABBA<741-(#%'&(+)=@BDFGEC@;752.*''((*-)@BCEJKGB<;9730//+))*$U .BEFGKKGA;9841/-,*))#U@AEHHIKJD?:850,,)'())*"UNQLIIJKHA=:62,(&$$'*,-. IifWUPJJIE?<:50+'$#$(,022 I[ZXVRLKKE@><940,*(()+/565$OQTTSRPKFC@>940..,+,/3787#@OPQPOQSJ@AA>6.,,020//47889"JMOOPRQKD>?>95223665448:98:"LOOPRUOC@??=8678998778;<::<"KPPQTUTLBBDCB>;97655678<>>@"MQQRYZRJCEHEB><;9778:;=?ABBC NQRT]^PIGKME=78<==ACCEGFEHJK JLNSXYVMKOSUPKGDA@?ABBDFGHKMP FILV_\VPS\`_XQLJJIGJMORVIGGKOZe`ZV[gki`WQOQQOMPTUX\IMMRX`hfa]cosqh_WRQRROQVYZZ[\_d OPW`homicfmnkgb_\Z[[Y[_bdbabfj PSZepyvpied`^_chjjkjhiigfgjm> ;%h:-k8 (n7H~6']5a4#[4!_3&t2(a1*w/9v/K.E -; ,% + [+ X*F*7([(2( `&2& 7{%E$G# -#X# t#,"=! Q!i!;! T! c!|!g = 63 =91253,(3 9;945861&"NJFA><:889<=BIQY]ZUO4>FIGEB@=;98:>BECA@BHOU[][WQ1ADDCBCDCA@>=<<;==>?>>ACEFHKOSW\^_aa^98EGHIJLKJFC@>=<;;<>@BBCEHKOVZ]__]\\ N>BEFHIIJIGD@=;977:;=?ABBDGMU[^_^\[[ N8CFHIIJJHFDA>;964348:;<<==<;:;?HPUWXZ]^]Z31KKIEFLNNMLMKHFDA=85200148:<>?@?>=<;;>BFIMPTY[Z RPONMKHIPSSRQPMGED@;40-,-157:=ADDC@<989=AEJPVY@zVWTQQROPSUVUSSPJFD?:7520/12248>CFIJIFCAA@?>>AFKOQIORVXXVSTUTSSTVVUVTOLHA<;:865310139?DINOLJHIIGEBCEHJLIOVYYZXVUUTROPRUWYYVPHA=;=>>:642247;BLU[YRLJMNLHGIKMYYKVYZZYWUTQNKLPTY\`cc_XOD?@AA?<964458>HUaa\VTUSPLKMNOYYDSZ]_^\\[XUROKGDGMSZ_dkprndQFB@@AA?=;:9:=DP^cefd^WPOPTTQX\]^`bddca^XRKGD?;9:?FMT_nvwuodZRJDA@ABCA@?@AJW_ejljd[TQUURTW^`aadfhihb[RI?;840-.28?FShsvvusmcYNEADGIIGFDAFPX`hosqi]UUTRS]bfedefge_VMF?953/+')/6<:@PcuzwojhfaVOLKLLMMLJKOTYahoqpjbYUTL[_beihggfd^VKC>:6420-()09>76>Rkx|rmmkd\VQNNOPPOOPQTZbinqqmb[Y9Zehijkkjf^VOF@=:75455215?F>98CWqsmigec\RNNPSQQV]fhhnqojblnooqqomie_VPKFB=<<;=>?HNF?:APh}xqjeda\WSQQRROT[cefjorqkswxyzxsld[RLIHHF?>BEFAAIMMTWOHCGR^noc_bgc]YXYUOMNSY^cfghmqrsv|~zsiaYPHB?@DF?<=DJGFKT^baZRLMS^ly~seadcceea[RLJLPTZafjknqtv}}uj]UNF?967>B?;8?HJLNXgmme^WUWbnu{rfaadkmhbZRLKKMRYbghjnw|ztlbWOG@942347<=::>JUZ]_nypigedipy{x{k`]bgijjf`[VQMLPW`gl{~ukcYPHA<7322029>@?@MYacap}wqomlnr}~x{wi``chlppmhb[SLJLU^e~znbYOF@=<:654357?LQSTYcjoswzxpnoor~}y~zofcegjmpnlic[QJJOXzreYND<987643347:AKU]afmty{||wtqrx~{y}{qjfgjoroljd\SLIKQqh[NC;5443226:@DIVdpx}|wsrwyu~umknrsmhe`ZTPNNPeYLA;9:9767899>DIPXdpz}{z|{{ztppqnlkgb[VTT[OC<:=A?<<=@BDIPU^ju}}|wtrqqrokd^[ZZWOHEEB?ADHKOV^eo{~~zusutrnic_^TOLKLLKHGIMQV]fov}~|xxvtspjfdSOMMOQSSRUW[cmx}}{vssrolQPRUWY[ZY\`eoz~}ytqquvrSUZ]_aba`cir{}~}vqpwzx^_acdfiikqz¿wrsw}~xtvzgghhikoqu}¾ymlpv{~zwzkjmopqtx}þxpnty||}ghknqv{~xyz{}`cfkqz½{{}cglryý}|jov}ىľ}rv~z~ž텄ÿƾüüÿg = 63 A:-&%'' (3 !<=90+*,, "EHHD><<:877889833;BINPMMO5>CDEC@><:877:<==;78@FMOPNMN/7?=;=CINOOPOL97@HB9?CDBA?><:98899;?@AACHLNNPOL93?EFDCBCCB@=;::989:<<;<@DHKMNNMLLMM ;"?@ABDFFDDCC@>;976678789;;:9;?EKNNMLLKLN ;:CCEFFEDDB?;742100356657753125>DGIJMNNM3#EDCABFFEBAA>:4/+*+.1467887541047:>BDGJKL !<5CFEDCDGHHGFDA?=950*%$'-2579;<;;<;61.-.38:=BGK@w[QKIHHGGHIIHGFEB?;852.)()+.0247:<>?><97543357:=AEIFEIPOKJHHIHHIHGHGEA<8652/.-,+,-.159=AA?>==;:8789;=?IELNOMJHGHIFDCDEFGJKIFB<7654420,)(*.17>CGEB>=??<;:;=NNDKMNNMJHGGFB?>@CEILNOOMG@:774/+((*.4;CJJHDBCBA?>==NNGLNOQPNNLIHGDA>;9;?DJMPTY\XOB:8668962.,,/38@IMOOLFB?ACCA?|OTWXVUTRPONIEA=952./28>DLW]__ZPHA;65576421346;::;>@>>?@BFJNRTSOJFDLYYXUUVVUTPID>83/,*(&$#! *2+&%1F]lkcWQNNMJC<99<=<=>?@ADJLLPSSOIdb^[ZXWUSOIB=:62.,,+)(*('080)%-=Sepod[TOLKHDA>=<<=<=>?CIJJMPSRNfeb``^[VOHA;8874.,022-,3429>6/+0:FUjsqlbRGFHNKFA>?=::97679=AFIGHMceb\TKB92.)"!%**%#%1:;<>MVKDEEFIOWYWampoi]MFCFIKKIEA>:7548=BGLde\SKC;3-)$  '))$#0;@?>LXPJKKLPY[U[ejntlZMDDFKMNLIEA<7436<:975G?5.(&%$##""$+15:@HPWZZ]``aed`XQQRU\aZUW\cedc]TNKKIGFDA=;:99@91+&&)((''))*-29?DHLT_dehjhhjmof][XSYbb]UV_bcfe_XQMLLIE@<<=:420.--+)+-/0148>8443220/03579>BEJRZbhlosw|}{uoqrnkke`kqib][[\`fhgb[UQQMHFDBA@:7534687788:<=AGNV^gotx{}zsnmt|yvtvzqe]YXY[]_bb\TLGEGHH=>@A@ACBCEINTZclv~{uruyyxwx{zvkaXRNQUZ\\XSLHHKNACDEDEEGMSZ`hqz~ywwxyy~xm`SIILQUXYWQMKMRFHIHHGFGKPXaku}yvwyyvx}~qaPHEHMSVWUSONOFGGHJMQW_kw}xvzyutv{n_SLJLOQSVVTROAABDJQUZ`jw{w{{wrow|~ype[TPNMNTXXVRBCDEHOX^emxÚ}|{{vrpqtsne]XUSPMTYXWTEHJLOV^hr|ʘ~}~|wlgjie`[XWWSNTXVUTLOQTW]dp}ܟ|qjid]\ZSORRQRQORUX\`fo{堡wpldZZSPPQSPOQPLXZ^cir~}zsi]YY[ZTQOQTVSN]agmt~~|wl_YW[\ZTOPTZZTbipxϤ|zyoaZVVY_ZQOS^a[flu|wzui^WUW]\YTU^bbkr|w{xqf\VUX[]YW\aet|~zwtqk[RRSVYZY[a{}ywxtcWQPQVZY[_˨zzxncXRORW\_`모玉}~}vnd\VUWZ]_쫩ʒ~|vpib^[Z[_ؘ~}}wsolieb`̰~{xvtrnid٧~zvsqqrpj򩬯Ͳ~zvrqqsqkࠝ|wtssrnh  7  $)'#"'-//..- %&%# !"&+//.-b!#" !"$$"!$!#'+.1120,%$  "##!!" !!$'%%)-/12231-$""#!#"!!%+,,02320.--./ $(&$##$! "'(*.1321-**,.  &)'&$$%!%*.12.+**+ ))% "&(&%##"" !%(&%()) !)(% !"$&'%#"! !"!$'(e$ $('%&%$%(('#  "$%#"$$#)(#$('%(($%*)(*)%" #%# !$!#%*+'&'&$#!!&&(*+(#"# !  !!%)('**'&&%#  %&'(*-,)%!$" ""! !!!$(,+))(%$%#!!%())+/10+ $$%$""#%$#",(+''+-,+**($" #*.132)##%&(*)'$##$$#*,**/0-+*)'#&,/351,'!"%(*,.,'#!!"#&,0.-..-*%!  (132-**)&!"&(*+,*'#! "'+00.-,+'!    -33/,-,*'#  "&(()*(% $'$%(*+-.-*'#    1<<7.)&(($#%$$%&&%"20+*++,*'#    )7=<3-(''%"!$##"#$''$33210/,*($"! )6<:4-&""#$""##"!$&&11330,'$!"/6862.)"!#%'%"!#""#$&0/11-("!#"! )024573(##'+*&!! !"%130-)'$   %-(%$#$$&)**/6::5.'%%$#""# &34.($#"  $!&0,(&'))+(-38;<7-'#!!$%%"!52+$ "$$'*,*%%(()/1--.16;;5-%""##"!"$$" 2/'! #%&(+-,('').10//.19<92*%"!  !"" ,*$ %*(&',00/.,(()+-122-,5:95.)$  &# '-/0036557740,--/0,*,1861.*%""  %*/588:;;>=721/--//,'*44220,)'&$"!!!'.0379;>@@?>=;=<8420/45,)+.14431/*&%$$"  #%(.57:>@BEGFEC@=?@<9852782-*,/354551,*('%#! !"!"$&(+16:>CJLLNOMLKGA>=<<><976971-+/225:950,)'%$" #$%%$#$&),/39=AFLPRQRSPOPKEA>;;<>@<9<;71,./049962/,($#" %*,*)(''()*-27>=;61/..133220.)$"!  !$(*,,+*,.0027?FLPSVXYYXXYXURNKKIC?=>@@??><;:61+)(*,..,*($ "&'*+*,-,+/2677:@HOUXYYZ\\[ZZXSPOPOIEB?=?A@>=?A=6-&##%)*)*+&" $-.//.--++.37;@GNTXZZY[\[YXXWVUUSQLIHEABCB@>BEC>6.&!!#%),*'&%&--..--../15>B>86564/,*+,,'"(.-+(./25667=EOYaa^^`bccefdccbabb]ZYWSQNJNXZWSMC?@>;6574.,*(()('*,+)(10479;>EMX`fd`abddcdfedeedee_\ZWSPMHKSVWWTICA?>:895.,+('())+,+)'557:AHR[bcdhgfikigffdhiieb^[XTPMKKJKOSURJDABB?92/--,)')+--*;=ADGP\cgfgjihjkhfefgffghjihda`^[VQNMMKIILUVPHBAA<40-++-*&%'+-.:<@GP[fijijmmllkhggjlkihikkiecbb`YRPPQNJFFPTTNF=:>=72.,++*)'&*--<=CLYdmmkklpqpnljijmonkjjlljgdccbZSRSTQLEDKQURJ<6;<:50-+)*+)'*,-AELVbjnmkjkortrpnmkmnlklmmkifedb_WRSTVQJGGKNPPLD=:9:;8.(()+*)'*0FKS]hmmlkmqtvusqonnonmmlifeeb]WTUVWRJIILMMLHB=<=?>2*))**(+1IOXakmklnoquvwxwrpqqrmkjfcefgc]ZYYTMJJMMKKHEECABA92-*((*,/0OU_hnollnoquwwxxuttsrsrnlkfceghd^]\ZZVQMLPPNOPKGDBACC?:3.*)*+-.U]fmqpmmnptvvwxxwutrqqpnlgdghhd_^^[Z[YUQOSTTVVPHA>@CED@:4/.-++-]eknnmllmmptvwxxwuronpomheghfb^][XY\\ZVUWYZZXTLC??ADB@<:997321cjmnlmnoopquwxxywtomoomjgihda_][XX\^^[YZ]__\YSJC@BCA?<=>>=;85hkmnmptuvvwxxzwroonnmlha`b`^[Z\]^\[\_ddcc^SLGGFB><:778<<8klmnqtxyzzyxyzz|zvsqoopplhbbca_^^\_beffhe\SKIHC?=:767;;7oomovz||}|{zy{}~~}zwurpqqlhedc`^acb`^[\accdfjjcXMKJFB><<:99732")$ */EPRTXhqqw~ype_^TIECA@B!":`+>Vs 7Sp0R.E`}Eo"8Tw"@g& M}(  1\+ "Iv+ ?l/0p/:d2B5)j65n8 :8N;; ~@=@1NLJLMFN,POMMNONLI@1N,VSSRPOQRRSW7@%ZVVUTRPOPQQRTTY^[XN#ZXXWWUROMLMOQSVX\]ZWJ#XVWXYWSPMKLPRSUWYZ[\^\UG3URUX[ZVRONOSTTSSTW[_a_ZO/3YWWXYXXWVWWVUTUVX[_``\ZZYF]_ZVVX\`ba_\ZYXXWVX\ac`^]]^V!V[[]`bccbaa`^\\^_`acc_WYQW[^begeddecbbca_^_bdfgfc_WFPIRXZ\\`fhigebbcfijjhfeefgfegiie[TRIRVZ]]_bfiihdccegijjkighjlib^_\M@QSZ`ca\_dikigea_`dikmnnmkiimnjgc_TK@PU\bcbbdghhfcaabglnpoonlknonmjd]WMUPOQV]difb]]bfijjea^binpooponopqrqib]XRSU[`chic_^`cgjjiklnnoqrssttuvsojfaXIXWTUY\_eifc__aceilnnmnopqsvxyxvvxyxtpmje@]YUTWZ]^_dhigc][aeilpsuuw{~}wuvxz~~zvmae_ZXY[]\\bgkljc_acfhknrvz}}zxy||xth;nib^]]^^__bhnspkgefdcdit|~~}~{sgsrnhb__`bflprsrpmjgdbdkt}~~~wJswvqhdcbbejpqorvwuqnjfdelw|r` ptuurojgefinporuxy{zwrnlmpw~}{q_ imqtxvrpmihlnoqtvy}}zwspsy~~|}wpN _ejpwzz{yojjknprrtw|}wvww|~}~~{vhN X^ciqw|{tnllnpprty~|zy{~||}{vnp TX\ahqzwplmoprtvy~|{{~|wd_p UW\afkqx}xvuttuvx}~||~}yqEppYX]adgjot||yyz}}|~|vngm]^cioopv}݁}|{w]mcb``agnpqu{ㅍ}xp ifgfaciouwz|wUnjjfimrtxzqsnnmklmpu}~{}yxwutronnqw}~z~vCƃ~|zxtqqrsxyy~~f|zxywtqr{x녇}yusyߕ~~}|w݈̘ٓrϗÞ㠟t{즤ڬꠞ檤񙛝ș攓㖜@=@1QSTWZ[[N,PQSUYYVPI@6N,KLOSWWTRPNLLOZ@%IMQTTRPNKIHIMNPTWWULv#LJJKLMLJGDBBCGLQUWWVJv#LJIIJKJGDBABDFJMOQRSSPLE3JHJLNNLIFDDFGGFFGJMQTROI63LKLLMKIIJIGFFGILORSOOQSV#FNMKIKNNMOONKIIHFEGJQTQQSTWQ!HKMNPQQPOQRSRPMKKJILNOQUWXUO$YCGKORSSRQRTTUTQOQRROKKLNQUWWVSQLVI@DFHILPRSSROOQTWYYWSPPQPPORUVUTSWI?CFHHILORRQNNORTWXWUTUUTROPSVWWX\\R@?BHLNLHJNPQPONLKLOSUVXYXWUQPVZY[][SN@?DHLMLKKLNOONLKKLOSWYZYXTRUXYZ[XSOH9?>?BGLQNJJLNOQQNKHKOSWY[ZXUVWXYYWUQMJA@?AEHKNOMJHILMOPPOPPRVY[ZYZZ[\\VROHICB@@BDFKONKGGIJKOQRRQPQVY[]^_^\\_`\ZXVJFDA??ADEFJLLJHFFIKMPSUWY[^adec_]]^dfd_TJKGCA@ACDDGJMMLJHHIKLNPTY]`dfhhecb__dhgea^U0QLHECBBEGEFKOSROKJLIEFKU\adfikmlidaachjjd[QRPMHECDFGIMPRSSQOMIFDFLSZaehkopokgcbehigd`KQUVSNIFEEHLPPORUVTOMKHFGKS[beinrspkebcehihe_M NORTSPLIHGJPQNPSVVUUTQNLLNRX`glopnkfccegijgcYG GHMQTSPNLHIOONPRTVVXZZWTQOOSZbhkmljgeefgiigc\V? >@EKPRRSSMJKMNPRRQQV]``]ZWUSTYbhklkhggfeec^[S@ 9@BEJRX[]\YUTSSTVY_dgijgdbbccflqtpjeccdeggec`[Ka><::>ADCDIPW[^ZXXYZZ[YX[]_homiedefgintuspkfdcdeec`7a@?<;=ADDCFKQW[\[\]]^\[\\]enomkjjknrvwtnjggfd^V B@?=>BEHHILQW]`_^]]_abb`cgmqsspponjeirz}yuqnlhghgb`[CBBA@@BDFHJNQT[acb`^^`cdc_]cjpttsqmggku|~}zvrlihgeeg`ECCDCGKPQRX_efca`^^bde]VX^gnrttrolgemv}}wqlhgghjhLHHGEDDFIMSW[_bcehgecdgc^YVVZaimkhfeehmt{}vromkhjlpPMMLLJGGFDCCHPSWZ^bgkkieeiif^WQQW`ggebcfghmt~}xusrollnr{{OQPNKIHGEABELTX[_cfghjkkjjf_[[^ciiddfhjjp{{wutronsxvPRTUTROONMKHFEJOSW[`efghikllmliea``bcbcfhjimu|~yxwtqsuuRTVWXWUVVSSTQMLLNQV^efebdklljknmhc^WW]adfhhkow~{|yvsru}VXXYZ[[YZYVTSRSVZ_cdcdfiklmpokhc\Z]_aacfjnsz~}{yvtvwWZYXY\^^]\\[ZYXXYZ_cedbdhlopolljea``^_chmptz~|{{yxwwQVYZZ[\]][ZYWUWY\]]^`cc`_`glnonomiffedba_aflrvxxy{zz||xyNRWZZ[\]]\ZXUTUWZ\]^^]^bdc_]cghjlooljjihgea_ahosttvyy|}yz~~NPSW[^__^`^[YYWVUWZZ[_dhkf__`_bflpomkklmlhdaekptvwxwvxyz{}}RQQSX\_abdd`^\YWWX[ZYY\`eigda^\\^elpqonmllmlhfhmrwyyxwwxz{{}XUQOTX\aeghgc_\[\^_^\YX[^afifb^ZX\dnttrniiorqkgjqx||{zyy{zy|`\UQRSTX]dhjhecb`aeec_[[\_dimmhb]\_gowzxpjjowupoqvz}|{zz{}eaZUTRPQU]dhjiigeeikjfb__`chptrle^\_gt|vmgkxzyutvz~}{yxy}xcb^[[XUQPUZ`dgijkkjlmlkkifefkputmbYX\fr|yrkkrw{{|{|~}wttscbca`_]ZUQRTX]begjjijkmoqqnkjimvyvlbZX]grutqopuz}~~|wvulbddca_^ZVTSSVY]`cegfegkquwuqmnv{~|ud\\^clswvrtwxz}}z{bdeec`^\YVSTV[_`accehmrvxwttx{~{nd_]_dkswxvtwxx}}bdeege`aa^[WUV[_^^`accegkpvzz{}|vnea`^akt}ytvvrwacbbdc`bca_]ZY[\[\]_abdiklorvy|~~{tlgc_^clx|{xtps{bb``cb``aa``^\ZZYZ[\^`bghfhkou|yrlfb_`frz~ztopugdaadc^[Z[]^^\[ZYYXY[\]__cgkpw|}wogdccfksyzwoot|hecbed`\XYZ[[ZYYXYZZ[\\]afkpv|~tjfdccfkqttpnpwggeeffe`\ZYWWY[[ZZ[[]^_chpuw|zniea`bdfjmpnlrz = 1-1454'',,-0343+!',+,.132.,+,-,++8/+,.00.,**(&$%(*-,+'@#,))*(&$#"! $(+,,'@#,(('%&('%#""$'()(()%")()(&&((&$$%&&%$&)'$&&)((&()('&&'&$""$&&'&%'/('%&)**(&&($"!"#%''&(.'!&''('()**('(('&$" #())*-+'&$&&'((&&()**))*++)$!(**+-,+&#%'$##%())('%'+,.010*%%&''(+--,)'$$%$"#$''&$&*,-/01.**)()+--*))($ !"$&'&$##%&&'(()+-..--,+-.+**)& ! !$&''#!#%'(('&%%&(+,--,-,*'#" !$')%!!#&''%#! "&*,,-.-,--*(&%#"!$%%$#$##$$##$%%')'(*.0/.-+(())("$"$"!##!$'%$"! "##%'&%&&%&*.220-)&'*..)'(&e$&!!! !#%$" !""#%&&''(*/464/+()-5720.,%&! "$$! !"#"!!"#$%')*/4763/,,/57541.%L&%! $&$" !#$%#!  "&(*.368752113763/*%&#! ##"$&&#" !$'+-035886641134320*H&'&$""%&$!#'**('%""#&*,-/279983001343.'# '(% !$'&$$&*,.,*(&##%'*-0479:942234420+#h #$$&*($"!#%&&%&),--.,'%$&(+.258:94223342,(N  &((''&#$&%&)*')-24/,)()),03577300/1332-*# $(*+,)#"$$(%'*/20/.,**+.14785220012210.+() %)-/-%"!"$&'&&'),.130-,,-037986542110131/-(&) !'+,*'%&&''()+/36420012456899852/.04542.(00!%),+**))(()**,/256543345337:;;940.036741.))1!$)++,+-256751144358<=;851034432*1  "&(*++,,+*,03687335569<>><75455430  "$&'*++*)+-..158:99878649@CC?<9::7443+ #$%'),,+*+,.-,,/36:;;958=BDDB@?>9654543.j#$$%'+--+.-*)),158;<=><868=BEGFDA<865665!"&('&(*-02210/.--,*,16;<:5579EHHB=9878:=A=%$$%&%$##"$%%')+-.001465420/./36776899;?EIJF>::;>A>*&%(*)'%&'&&''&$"#%)+,,+-135446400.056677889?GQQD?>==>??=**&&)+*(&'))*)'&&')+-/1245665332001334789??@@'&)**)'(*++*+,..-*('(+.343346755665320011258;;AA??@AA??BBqq'(*,-,(''('&),/00.+*-.,+*-/026678755237:;:;<=<>@@?>>@?%)+,+)((+,)'%&()*++*,030,--+-134455787543357:;<<=<;<==B(''(*++**--*'&&''())')-31..-*+,.02356877985458;=>==<:9<==>CI-+'%'*,,/.+))*)(&%%)/110.-+)*,/36779==:767:?@?>=::==?BB.-(&&%&).10/.,++,+*)(*.12231-+,/369<989<:9<>@@>=>GJ..+('$!"&,1332/-,-.//..-./1235762/-/25:?<86:@BA=::=ACDFEB@?=;;9:=?@?>>@BDEGHIE?;88032.+*+,*'$&+.121//112234432127;=71,+/4:<<:9:==0210//-)&&')*,-/21//01369:658;>?;1,,.124689;9;@GKLLJIINQNLK0//0210121//-+)(*,--./013579;;9;<975563115:=>=;9;>CHKLJHGJOTVN3001331220//.,)'*+**+,--./0248;<:<==<;:864248=?<99:<@DJMKIFGKTXQ5312540/.+)*+,+)(('()**+,.12457:<<::<:75445;5565448<:889:;?HMOOLHGJOU1/+*-./.-)&$&+,--*%&)*+,,+,-/016==<BHNOMJHINV@@<1("7zkK# 3ƭwh[I0/ôx[B+ )ɼeC# ) ԷkG+ & ׵Z- %ϰuY3!֋=!ҝ_*n- ЖT۠[* w2 čO !Y!ߨY!#Z#V%V&Y'? (~7 (זA*ن> *Ղ- +w,,b -j% .\! /[ /9 1ٕE1т5 2v"3R42 4]4υ"4= 5r-6Y 6+8_!8I8x$8T9ٗ69]:|1:I :` :m:{:!=>D:H=R(<VN@;XTR;=E<u;C;!ᖜ» ᣥ¿ 񰱶ޙÿ 㳵 򯴻 𤩬 ឧ ᛠ ᜚   鎍"㝠"㓙"㏝"㟧"""㤪""㥪"氱#淺#Ż""##"""""      "ʻ"³ѽ"κ"̸"˸#˸"˹"κ"#̾$ $!㗝 랢 𥣦 챰 ᩨ ᣩ ᠨ 잣 ÿ 󫪲Ŀ 紸¾ "夨"㚟"㒟"㜣"㥧þ"櫮"笱"㬮"㪬ž"欫ü#稧û#㢣ü"㣤¾"礥"靠"㚞¿"窨"㸳"漸 U#骫 "㕙 ᦧ򱰯 x ju ᚏ|ak{_f~z^d|񶵷 z]e}!ᛏ|bj 䇒lt} ᬩvo 𖔞uig\\{"姨x\POJPp"𥪭gL??@Jj]G=?BNk"񸲩zYF?CGTq"깳xWE?EIW{"꾷vVC?GPb"uTB>GZv"ĩvT@=:8qvz~~}~~}{ywxy{yxzzxwwvrmihgecbdfhge`^cfhgeefgeba_\YWRLGDC@BGJLMOSX]cjry~{wrnkifdeedefdb_[V{wsolie][^[X[`h_JA?GLKKHDB@<;ADGIKGDKKC<8898;@EFDEMaszwwurpnlkif`YQJFF~zzxtpld[ST_oμZQR2)HZ^RKgshWE=99:=?@9Q\]Y^l\NC<89;33A\}}unloppmh`XOGA?>>xxzzywusqpqtqpvYBDIKKLXkr`NC><;32=X|womnqqng]QGB?>=CDEIdv^MD?<31>Z}}vssttrk_QDA@<::wvwxwvuuvxz~vnkf\L??BDFLf}ywp\LB<813E_}~xuudrk_PBAB?<9tpprtuvwxxz}~ztng_VNIHKOS^gjg`YSQNF?930/9Ph~zurrttqh\NBADGC:rlkmqtvxyyz{|{wrlfa\VQNOQTX\[YTOKIHEA:428G]q|wsomprqiZMCAAD@5qlhimrvxyzzyxwsojfd_[XUQPRUXXVURPNMKF>:;>JYdo||xsonlkmqxug[PLIB<9wspnmnruxz{zywrnjhgec`\YWVVTROLHD@;>JWdmtyzywtqmjhglrzyo`RPNIB9xuronnoqtvxyywsokiigdb_\ZXVUTQLIFBABJXbkqtvusrpnlhedks{{teVSRME;zxtqpnmmnpsvwvtqmkifca_]ZXVUSPKGEDHS]ejnqssqnmlkjhdbisz|vj\VSOH>Ԭ˥㱲㱮ҤĿ霙跳򨤠✟¾ſĻٸþȾ½żÿý񗛜þƾûý¿½ƻķŷȹ}¾񹽽̿љ"ľ½پ༹eZXTRQYkõdD87=?42=dõ|ZM:/QgR@9`ijôwX^D+]cH5^ʸİɵw]pR,[~aD0Zʶɸb_H2L^L<4fǽnK>>=<9:D}Ź®mZSMKJWqػ²uqqpߺƼػž2lkjhecca__][\_abba`^]^`bdhnvyxxz~|zzxuojc``_`bfmnmpu~ropmgcabba_bgjjhghebabegjnsz|xurvytpotyungb_]]aimpprzttwwtngec`^^`bcdeeffghkmooqwzwsnorusmpturke`]\]`flrppw}vuwyyvojf`^^_aacfhjlnprstusrvxwsomouvqprtsnjecabceksrpty}wqnotwxrjfbabfhjostw{~~|zxxwvvwrpsvxwusponoomjgkrtsqs{~{}xqoqtvqjfc`adfiptwz|}zxwwy|xttw{ytpmkmqtusommpstqs{{uv{}vrqpmieb`_`acjptvwz~~yy}|xx{xrnkghlswtrtrnpstw}~vsx|xsolkifaaflruwxy}}wqkedgntrqrqooqv{}x{|zxtofbeiotwvvx|򉋉}ulfccioopqqopw}}yohfhkpuvwwx{~wqkgegknprrqrtx|{rlhhlrvwwvvz{vpljhinrssqsux|tkfiotxxwtqs{vsqmkpttsrqrx}|vzyplmsxzzwtu~}yvokptuusonrw}zuuz˙vquy|}||}zrmpswvsnkkpy{ytuǞ~{{z{yssuwuqqplmu|}}Ο~|}zwvwuqtvqpt{zvwvuvx{zwvv{}z{yvvx|xvw~}wuw~~wxˠ{yz}ɡ~~򠢣ຽѣÿǟĿ򜞟ίĿ🡣ÿΪ¿ЭУͣ¿˵ľ¿ķ¿ʸ}zvssvz·~xtpmllmpsvwyz|}}ɿ~zwvsppqrsttssttvz||yw{ǻ~|{zxuwz|}||}}||}Ⱦ֌¿ŻKږǿѕŻϐùՐúЋǾψĸˆă{{|}}~µ|}{zzwtvxyyx{øx|~|vohggjnry}|{»vywtpkea`abbcfmruwz}ſsng]XW[_cb\WTVZZ`kv|}Ÿjg_ZWY_ehaVHCDCA>BL]q|ĥa^VTZcoxvaL:5688204Lixŭ_^[]fsgLB3(7T|x|{~ƴ]`fnwiQV=#EbXG6Xvy~w}ùYasgXqR'Qr_F1Vxw{V_o~pZaK1H[N?6aƯU\fpy{\F==<:8:Bq]`cfjr}{fMCB@?=EXwcedccgnv|zp^TPQRPYm}񻱢cfikklpuy{ytqonont~񼴩ceimoprux{~怃񼵫dbfkosuwy|~1.--.-,(*./00.**++.12337;;::;=:677420..037768<>CILMKIHLS4431/--.10-.012210/.,+**,166788765688620.-,,/57789;>BGJKJHJP8::961//.,++-./00/-++-./245445567861379841.,+,/48;:889;>AFHEGO<<=;741-++**,/0233112345568613688521/-.038;:8778::88:=@;410/003568;<=@@==>;889768878964454223589:88:<>>@AAE?:77:=9520.-.2678;<=@A@@<7789;><9889964247766566 9:88;=>=<>?AQKA:765442/+('-2345668:>?>:6568=CB?;:;:86401699889868:88;>@?>=@F\WPID@>;8630,)+-0133446;?B@=<;:=BEECBC?:63015788788988;>@BDDCACJca]XRNJFA=:840-,.0223359>CEEDC@@BGJKKJD<62124576679;87=BDGIIHEFLba_]ZXUSOIDA>;61//13579;<=@EKLIGGILNNKF@;63234568:;<98><7339==;9:<@HTWUQMLNRRNGA><;9:>A@@?=<>ADGIGHLPSa]\\^addca`ba^^[TLC<8=A@@AB?DU[[VQOPRSRLGC?;;=ACCA?=<>BFIEEOVZa][\^`bcca``abb`]XQJDBAA@?DHBDOZb_ZXVTUUQMIFDBA@ACDCDD?>CHLKMT[`b^]]_`abca`_acddc`^XQKGFCAGLGFLWehfda^\ZVSPNLIEAAEFFIIDBFILPUZ`fc``abbcbcfhfdca]YVRMIJLKKUdouvtrkb]YVRONLJIJJKLKHGPZbghbaabcdeehiggeb`^[WSRRTUTXany~~wme`\XRQPOMMLJKOQOLJOWcgf_abb``abbdgijihghifb``_]]^acda^ht~~xohd^VSRPNONLKKORSSNO^c`bdcbaacedegiihfghifcbbcdegiloqokms~wpke]VQQPNMMORVYZUU_dcfgedccegffggfeghgfeddfjnrtw{}|xv}wrldZSTUTSQQRQSY]__`ehjgigfeefgffgghffhhffggfegmrvx{zvpib]\ZWVWYZWWZ_deglpthjhgffefggfhgefijigimsy{}{wrmhdcb^]]`ca_^bgilqv|hihgfeddfghgedehgfgjnoljls{}䋇}zvrojgiklhcfjnleeimrtx~hhgfdcceggfddeghgikprommt{}{wuspljnqsqnoqvumlnpsuyhgijhfeddeeffghikmprpootz|xuvuqnmruvy|yw|{uuwtswz}jjlkhfeefghghkmoqrqqrux|wsvvsrrvxy}~~}~}lmnlhffghhiijimoqssttuwy|wsuutuwxzzևlnnljijklmmllmnnmnpqstvyyxz|ᇈztrppswy{}lnnmlmnoqpnnpqppqsuvx|}|~}wrompuy}kmpqpnmnoqqnnopprtuwy}ԅzvqlmpxmnpqqpnmnppnnopqqrsuwz}~텆~zsmloy莏~opnorqomkmnmmllnonnprsux|}vnlp{osppnmoonmmkkjgeeghhfddeginsuy~yonqzU^nnlkkjidac`][Z[\][YXWXYZ^choy{pnqxkjhgffea[RMNMLKKJJLMMNOOR]it|{pkku~fcba_^]WPIDBBCCBCDEFGHGECDOZeoy|pjir|uq_\ZXWUTOKIGBABCDDCBBCB?<;?FO[ht}}pjjoxzv[VVUSOONKHHJLLJJKJIHHGFEFGNZhu~rmmry|zyvWSTVWTOTXURQRUWVRRUUTUXYYVQKLS_n{uppw}urtnVTTUYYVZ^\ZZ[\\^_`aa`adfgeb]\]bju~vqq{}vtsWVWZ\\^`__`_^^_aaceghhikmoponljhjs{xrr~}xxwu\][Z[\\]^]]^]\]__^\^`dgiklnprtvvupov|{ts}vswws][ZZ[\[Z[ZZ\][ZZ[]`dhjknqtw{|{vuz~쇄}wu~~ooxz[YWVXWVXYXWVWWYZXWYZ[\_dhjnrvy|}|zz~yvrhly~XWVVXXVWWVVUUWYXXY[[]cfgkqux{}}~}wvuhaiyTVXYWVUUTRQTWWXXY[Z\adeinswz|}~|vt}ma]fy~NORTVVUTSRPMJLMMORUWZ`cehkrx|}||}}vs{j\\fzjIKOQRRQPNMLJHFHJJKMOQSUY]behouyzxxy~~vqyj[\h}FHKMNLIEA@ACDEKPSTTSQOMJOZ`egkqrqru}~tnwl\_kEGHFD@<<=??@EKLNOQRRQOOQUZaglnopt|~sltn]bmDFC>8427=>=<:9=?>?CKSY\\VMKNZcilopsy~~rjr}q_cm>=:6348@EB=88<<:546ANTWY\_YST[hnnou{톂|qjrvcah{96336>IRUJ?77:;:510=OXZV]idYOSfmmlmrx~텁{qkt}jadu{9869DRbnoYG=1)7DE@8Jdtt\SUYYKK]glnorv|}tnvuigu:=AJWgv}^MM8";SRH:RwwcUSSHIXenooptzxrty~rmt;DUdmw}ZQeK'Hd[I6VkTGGNZfpqonr{|vnkpy~{t7ATdlwbS[J4FUNC<`mYOPV`jrqonqy~~ue^do{uu2;JV^jxkTE@A?=;=Fkia`^ajptronqx}}q\S\fpu{6;CHKS]inbSC?@A@==<<<6m'6X6G464-4ݖ*;88;;;;;;99v9v<9;;;;U8U8;;;;;;;}<@<=;88;;;;;;9999u:;;;U8U8;<;;;;Y;<@<=TRQ;RQQI8SVWI8PUW;HOQ;GNN;KNM;MNL;NM;MPPLI9LPPML9NMMKJ9TSRD19[\Z;a^];ebb;jlm;hlmU8addU8c<ife;slj;|xv;~;~;}s(;{[<s@<v=vy&;8;9;=;K;T;Y;[;`;o9u9r9l 9a:L;:;ٓ1;ܘ2;<;8;҈,;Y;;;=;- ;o;C<=%%%$$%%$%%$&&&%%%"#$$%&&)**))))******+*+,(v(,'"'"a%A:b( )G"Q! 4& 'o%"!!]!R Q%JAA~" 9v"!" 7r! !$&4k!  !&*"-`H#&#!%("'X (*&!#$ Q ,.*"!"G.0+#"! ='..+%$"6ڮT:2-*&%#0}ۮy_@5-)'%"  +r%󯰰$򩬵%÷%Ľ󭮯$%򭬭$$缺$徼$ý$ʻ%󮰱%&%𮭭%򭬫%"Ŀ#$$$&&𰯭))ﰮ)𯮭)񯮯)񱯰))꯰)))))𴵵)*+,+'\')۽&*m&*Gf$9@+G'  3u"k 'b% R%#! Es |z$$"=j$$"8db"$"!1]"'!+W"%&#(R IH.*'# $L I70-)  GJO?2-(A PUF3*":UY]N7)4vS\^Q9(-k_[XM8( %^ڦue^XM;+ Sۦvf`[QA1# J%|lW[ix~~~}$tx{jhny~~$vxzy{~~$xz~~}~$z|~}~}~~$~~}}~$醈~~$튈$򃆊$倄~~$w}|}~}~%z|zy|~}~%y|z}~~%悆~}~%態}%懏~%"#n􁄄$s$mv|}~~~$msy|~~)wx}~)yz)z{􁀀){}~)|})}~))~)z|)z|)})x})kz)cz*w}*k|~*[|~+}+|}'N{}':쐄&L[k{~&L2EUp{~#@W;51=bw}% 7830(-Ur|"S:+&$%Lk{!fRK:(!!Cby~ f{ZG9%#;Wu} k^F5 #8Ss~|~$g^D.$9Ss}{|~ėeV>()8Pq{yz|"㙏dM6#!,6Kmywy|"撊cD. +3Hiwxz{~!b<($+?cuzyy| ᳲ_5%1\s{xtw{_4"+Xr}ytwz} ᪵a6 )So}xxy||}ᶻh: $Ll{xwxy{zrA$Eg~zwtux~xʿ{J* ?d~zsrv{qdߘƱY5 7_|tsuz~qdr̺mE)/Y}xvux{|%[%R%M%F%9%)s%R%G%@% 3%$&}& w& w& s&`&3~&J( y(0q*%}*i*e* l*j*b*a*_*U*L*D* 9* ,*#**+u+ e+V,F,2|,], ? ,T + G* V( ['A&B% 0%'n%O#~#M#+! H!!n! D!m! 5 PG;ǵӿϾǽƾȿ稦ࠢv񣢢틏蛟£ᖕ񚙘ծᚙ͟͝͠˝ɝأ⡥xm~jd|gbmqYc{¾–iTj½zdUt¿،wdZ}»ɓyjcڕwryx뤡vj`_hz{{~wpjggp}qhdflt|zr_TSX^cgnwre_afmqstv싑zuuw{~y}||xy|{馧ⓔ勍򧦥퍊ǔ呓Ɍ،ퟝߑ䧥őڈȔtjfip{ܳujdfnx􋇄ђrmorwz|z{}~}~~}{zxtlhghjlnoquy~϶~{vjc`^^_`adinsxzzyxx{}~~刅}vqlhc_]]_aehijiiggmrtwy{{θ~yuokgfghjlmnnlmrvy}{z{|}~벰粱𶳯➢ǝڗ󷴲핖ﳯﵲݗ鸷빺絴Ȕ}|xuusomlmnpqqoljheb`^]\ZWUSQONOTZchlnopqrpljihgfdbhpxzvncYSQLF|z{xsomkjjlkigfda^]][YVUUWZ]elnonnopprpkifddcgmuxvqi]TSQO~~}|~{wrnljgghgecbb`_\[[\[ZY\behmppommnppnjgdbabdfjpvxuqlc[VUV~~|xsoljfeeca_^^]\\]^_`adjmnppqomlnoomkieba`acglruvsqnhb[YZ~~~|yvsqnjgdba`^\\]_addfikmnooprqnmmlkhgfdbba^`elrsrqpolgb^[~}|yvtsnjhecb`_^^_beggfinqssttusqomkgfgeddc`aejnnomkgc^~}}{wvtnkihgecbbccdfhhggkosvxz||{zyxvtrnihjihgeccefhiklmonmmib}|{yvutpmkjjihgedefikihimrvz~}|{zxurnmmljhffeefhknqtutpl~{ywuutqomllkjhffgkljjlosw}~}}{yvtrqnkhggfeddglpty|zxu}ywvuspnnmkjjihfehjklnpsw{}}{zzvqmjhfddeefhkorv{~~}{zxwvtpoonljiijhfhjlmnoprv|}|zy{|}}|ysnjigddeghkoruy|{yxvttroomkijlkjjlmmkjjmtustvxz|}}||zwrmkhffghjmqvz}}zxwwvtponljiikllkjid`bgookosw{~~}{yxsolkkjjlpuy|{{xxywuqnljiikmmkifcYSZckkgkqx~{ywtqnnqolkmsxz~|zxu~zxwvtqomkjjkmlkhcZLDSbkmkpuz~|{wtrrusnlntxz~{wrmzwutsponlkklkhe[N@=Sfpssvz}~{wttwuqoouy}|wpj}yvtrqonmljhijkjhd\N=:C^rz}|~~{vsttsqrx~ztn|yvsrpmlkjhffhihgaVD2:Nk~|wuuwxww|~zu}zwtqoljhgfddeef`R>-@^w~{yxz}~~~zvsqomkhfefggfde^J8,Gj}~~yurpnmkifeikjgcd\E4/Mr~zupmkihgffggd`aZI<8Qpzrmpx~~}|zuokhedefgedca_`\QIFVky|tnh]VV^lx~zxxz|{zzxwvuux|zzyxtojfccdefda_^^aa^[Z\bjld^YPHCBHViz|xrpqsvwuqkd]YX\emtyxwvrnieabddca_]]^bfiklhdgf^YTPNMJHN[m|{wsnllosrmbWMFCEJQZd{wtspmieaacb`_^]]_djrx|ummib]Y[aiib[Yfs~}uqolkknrndPA857@EJMLKMztmjhec`_^\\[[]bjouz~~xyzxriddjpuurqrxxsnihilqvk^SMNSY]]XSNytokgda_^\[[]_biqvyz}}||{xtrppqsqnjikmmjgffilme\WW\acb]TPP~xtpkea_][ZZ\`dipw{||}~}|{zyurrokfccegeccefe`\[_fiie_VUY{vsohb^[YXYZ^djouz}~}~}}|zvtsqlfbb`_``a_^_cjkihfbdl~ytplf_[XVX]`ekpvz~~}}{yvtromgdcb``_aa`aabcfkkiinv}wqlhc]ZWT[ejnqv{~~|{ywurnllifdbabcddcdefhjihikmryzuoje`\WVXakqtvy~Á~|{zxvtqljjifcabcefebbcefgghhijlmrz}ytnhb]YTV`ipuxy{~}zzywtojiihe``ceghfa`cegghikllqy~ytnhbZUQYktwxy{~}|{zzxtniggec]]aeiigcabfjjihggilmqv}yupiaXSS^szzyy|~||{ywvrnjgfda]]aglkiecbfjlkiggilnqu~|zwrjaXTZfv{xww{~~||zusqpomjgdb``dkqnkgecfikliikmoqt~}|xskaXU\guyvtuy~Ā~|yvtsrpmjgdbbcfmqnkihgghkkjiijkmos}ytkaYV[dqtroov||zxxwuqlhfcbcehmpljkkjhgijihhilq{uk^XUX^ikibalv~~|{zywurlhdcbcegjlkjkkjgfghggjhjn}vk^XUVZab_VTamx~~}}~~}|{yvurlhdbbdfhijjifeffeegijghl}wmb[XXYZZWOMXbiqw{||}~}|{xvspnida`acefhhihffgffeegegm~xnc^[ZYWVTOOY_bdeegkotwxyyxupmlifca`abdfeeggfeedfin~ynb_][YWUTTXaea[RHDIPYdkmoqstvtlhhgfc_^`bcbbdgihgedd`inpzpea_\YWUTX^glkf]OFDGMV^`aaceiidabdedc``aab`adffgfdcdeebbjno{sida]ZXUU\dkquuqcVNKKPUXXUUW[]ZYZ]_^^_^_bbaccaacddbchkk|vnic_\ZXX_flquxwrle^WXZ^]XUTUTMJJKMNOQRSUW[\\[ZZ[[]_]Z[^aa`}yslfa^\[[binswyz{yvofcbca]ZXXULGEDDFGGHJLOSUTSSRQSUXVSVY[ZX{vnfb`_^^elrw{}||~{toidbabccaZUQNJIGDDFEFHJJKMJHIKOPPTVWWV}xphcaabipuz~}~ztnkklmlic^ZVROLIIJJKKLKMOLKMPSVX\__^}yqjdbcehmsx|{yxwvsnid`]ZXVTTUWYXWUVWWZ^`bejmm섅{tlgfghjpvz}䀃~ztplifdbabdeghfdcbbeffhkosvwx|unjikklrx|~yuromkiiloqrqpnlkklkklosw||uojilmotz~儃{vroljjklnpnmnmkkmmlklnrv{{vqmlopqw|{uqnljiijihjjiijlmllmptx}}zvsqqsstzztomkihfecacffgffilmnorux{}~}{xtssttuy}υ~{wroljheddb`adbbccdhklmnpsvz}~{~~}yvttuvx{}‚~yvsqolifbadcabc`__begijjlmptx{|{~~}zxwxyzz{}Ɂ~|xusqnkifb`bb`dfcacddefhjlnptw{||~~{z{}~}}~ф~|zxurpmjhfb`aa`dheceedcdgjkmpsvy{}~||}~섆~{ywtrpmigdb``bedcbcddehjiknqtwy{~~}~}ywvspolhfdca_^``accabddeghijlptvxz}Ӏ~}~}{ywvtqnmkheddb_^__^ababddcdfijkptvxz                ڶݻOnhilpsuy|~ztpoqsvzüƄzvuuw{Ê~{zz|~~󹻺댉䢣Ȓ򔕖諭誫ķ񒑑꭯ó񔓒ݘʿȾ𶷸ľl蘙 񝟡¿ ךüƟ򦢗ژ 魪㞢 쬡㟢 ˳ گ󹸹­ 즭㝠Ɣ Ԅx ˅ } {~}} |Ӂ 򄈉荏 񔖗썎 荌סݢѡ󠞜ꈉ흡쉍 㡜 򛟡㈆љј٘򘙛鍑Ҙᖗ𬰱≋ခ󭱴5|{qjijmosx}wwvtsx~䎐ԖѢ㫬ܮԭ㫬㫭𬮰宰󪫬ଫ𫩥s﫧BACEGIKOSTUUVXYYZ]_bglquxz{|zunhfglqw}~uph\Y_itLIHHIKOSUTSUXYYXYZ]afjosuvwwuqjddgntx}~si_TSZfrTPMKKLORRQSWZ[ZZ\^bfjmprstutqkfegnty|ubTMOYhuXURPONMOQQSWY[[]_bfilnopqrqplhfhmsy{}y`OKP\n{WTVWVSOPQRSTUVWXXY\_beimoonnmmkhhilqw|}bQOWewZWXXYWSRRTUVWXXY[^adgkmllkkllkjjmrw|j]`ht_\XWZYWUTSSUWYZ[YY[]_bdgiijlmoonllpuy|uowhc]YZZYWUTTVX[^]\\]^_adegiloqrrpoosvy}xwmqkc^\[[\[XVTUW\_`_]]^_acejortutrrsuwz}xy~}xsmhc^[\][ZZYY[^_^[[\^aabejoqstutuvxz|~}wz~{wrnhb^^__^][]_``]]^`bbdglprtvvwy{}~{{{zurnkgcbbcca`_bdeedcdegjnsvx{zxy{}zzvpmkjhfddedb`acfhhjklpuy|~}||~}{ojedffedaacfijjklmmnmmqw{~ꁂuie_]adffecbbcdefhjklmmnrw| gd\X[_deda`ceffgilmmnoptx|􂃅 kg\TSW^bcaadfggffhknooqruy|``rmaWQSZ_aabefgffhkmoppoprtx|{vj^TTZ\^_adffeeiklmnppnmnqv{ ~uiZUXZ[Z]cefegkmlnpponnqu{ 醄taXVWYVX`defhlmmorqpporv{ }h[UUVST[`cegkmnqsqooprtw{ ˃m^VTTQQW]bdgjmoqsponqtwy{ {n`WVUONTZaceiknpqponquxz|l lt~{h\VVRQTY^aceiloppoqtwz|W [dnm]UTVXXWX[]_beimpqqpqtwy{{ SY]\USUWZ\[XXY[^`dgjmnopruvxy} PSRQQSVY[]\YXX[^`begijlnqtuvw{n SVVUUVWY[]^[YXZ]^`deefgilorvx| ^aa_[YXY[]^][YZ\]_abbdfhjpuy} prqlb[XZ\]]\\^_^^_`bfhintz~ z|{vkc^\]\\[\^^\\^aegjnrw{~~}vmea]\[[Z[]]\ZY\`cglnpsw}~~~zsjd_\ZZ[]^\Z\_cgjmpqt{~}~|woic^ZZYYZ\]\Z[^cfgkopsy~~}z}{tpja\ZXVWXXYYWVZ^aceioqty~~}~~y|}yupf^ZXWXYYXWUUY]_aciorux|}} x}}zulc\YZZ[[ZWVWY[]_bjrtvwy|~~}} x}~~~zrh^YXYZZYWVWWZ]bjqtuvxz}~|{~~vz||{}~wmb[WWXXWVVTSW\biprtuwy}}{z|qtwxz~|tkc][ZZYWUTRSV\binprtvxz{{}}oqtwz~~zskd`]\ZWUSRSV\bimoqsuvxyz|}~}{opruwy|}|ungc_^ZUTTSSV\cimprrsvy{|}~zvpruwx{}|z}{tnieb_YSSVTTW\binrssvy|~}zupsvxyzxvxwqlhfd^WQRVVY\`hpsuvvwz}}||opsuxyyxwwskeaa]WQRUWXZ\`gnruvwwy{}}}lmpruuvusmc\XZ]\YTSTWZ]_aflqtvwxz{|~||adegkljllhb\UPUZ^]YUSW\aeghjnrvvx{}|{tvY[ZZ]\[\][YWRNSY]^ZVTX^dhkjknruux{~}yVPKKHFGJMQUUSVY[ZVUV[`dgkllprstvy|~~|v_^ZVVRMIGIMSUUVXZYVVY]adhlnprttuwz}}|zunoppqldXNKMQSUWXZ[YY[^bfinqsuvwwxz}~zywwyz{{zvn`SOOQTWZ\\[]_`bfjmquvwxx{~~{xrp߀}ytfZTRQTX]`^]]`bbcgjnruwxyyx{~|yRւ~{xtkaYTPRV]`_^_`acehmrtuvwxyy|~}{zw~|yvph^WRRV\``adgkptuuwxxyz|~}|zywr}~}{vnc[VVY]``abbcfjoruvvxyxyz||zyyxn|}~}|xrib\YZ\^_`bcehkqtuuvxyxyz{{yxxw|~|{{yupjb][\]^_aehjlrtuuvwyzzxwwu~|zzyxuoga^]]_bfjmotuuvwxzzyxxvp~~|zyzzxskd_]]^`dhknquvuuvwzyxxw|}|{{yume_^__bfiknqtvwvvwwxyxwwvu{~~}||{zvng`_`adikmoqtvwvvt[tt{|~~}||{zvpicaabfknqqsuvvuttutrsskt44]424`4J3<353ݛ+3{!3^2G26 1}"1c1O1? 1؆3 1p( 1Y 1> 1$ / /h /A .Z -ʄ( ,ʀ> +Ѝ: +R+/ +***}*q*b*M*ތ9*m'*S*? (3()(׉ (r(V (?(s)(S '9'(&t&A %q%N%Ԃ0%L##X#r.!8 !g!v) @Tk^B2+((# !  &ey|eY@-*(("#$  #ZywaO9)()(%!#" %ZokZF4'))(&%$! ,Zg\P@2),*%&(%## %5/,-+'')(),05;CMWJH>2,+,+)''((%',17=CK~ٞ_KG10.,-..012.+-/212:65320ǯpP;54432ܧi?66544[E9876~ZB=97¼uSA75௱kL;6^D:uV@窧oKӹ`yǰrne`\TH7'!  >{ýcnkie`]VM<+&   3sľghecfe^VN>.)" 1qſtc__de\UOB4,% 1ot`TW]^]XTQH=0'"  1kjr]NS][XWTPJB7-) %0fjfYJP^[WXUNJF>6/' (.aّoSMKT_\XXUPMJD<2+'#!#&+YtLDNX`]YWURPMIA4.-+(%$(Q{QEQX][ZYWSRQME91,+*'')K~ꪓZITY[YXXWSSROI>5.+**EpeQWZZWTTSRQMD<3-*,-,?afRXYWUTUUSQPMJD=3-..-9TՆdPXWSTUWXWTQNMNMH<1/..5H}jRWVSTVWWVTQOOSRMD;3//1=pդtYVSSTVWVTRPPQVUQKC81/.5`ԟhSNRSUWWUPLOSVVSOG;1-*/Mu ףzYNOQTWWTPLNQUUROJA80+-<\ ՟hTLMQVWTSRMLRRNMKKE91/0F ѭm[QMRTSTURPSSQPONJB80+7as[LMNQUWWUTSRPMH?4,/Bb 䗚sYGDNTWWUTSQQOKD;2/4JoUڝjJ@JPUUTSROOPRQLHB:3/:StU⟝YECHPTUTRPPSOKHD=10;Tt锘rZGCGOTSSRRQQNLJGB724AWt ˊyUB@JPRUVQPSSQNKLJF>64;NhƚcG9@GLPSQPQRROMMLJFA;9=LdŘ{YA:;@IOSTTSPMKIGGFEB=6{qX?=CJORSSROLKLKIHHGC<tUCGOQQONMLJFDIHC{usu|~X>6=LOONMKJHIIGFDߛ~{vvx|~~kQ::EKNNLJHIHEEF~|{{|~{wvzxy{hJ>?EKNOLKIGEDEH}yvuutuy{|zyz~|gP;>FJLLKJHFEFIxroorv{|wuv}~{dA;>EIJJIHGHIѓ~ytrswzzwty~y{wR<3@GFHKKLKJ|usswyywv{}yv}jL8:?CGKMNNMJvrrsux{}{xttygI64AGJOQOLIzvvwy{|xux}臍z_:/?DGLNMLK抏|{zzyvv~uE1<@CGJJKL~zwxyy{}}{{Y>59DIKIGG{~{xxyy|}zvvz~xlQ65AGJIGD~z}}{yxwutsv|}|y{~|hA58@GKJF}}~~|wuttsvzzy|{W?3:CGHH{vv|}|}}usuvvuuvwz}qQ57>@DI~xustx|zxwtqprwy{hG=:=AF}vonry~~~}}|yrmmqwz{|~}_H;<>Bytsttv{}xsrwxustvz}wZC<=C󕏈~{ywsqtx}}~xtuzysqruz|zz{lSA|vonqtvwy{ʁ}yvsqruxz{zyx|~zu|vVC=}vsstssx~}ztstvxyyz{}zvu}}gR@{zxwsojilry{|~yvttux{{vw}~|jM~{~~{unfcgmtwz}~|xtsswzzyywwvzzz|]~zukfgkqtvw{~{z||{zwvuutqtxxy|~zs{|pyzz}~{snjknprsx~{z}~}{zzxusqorxyy{|zvt}{{}rrsttx~}|yrmkkmqw}~}|}}~{tqprvzywvtsw|wzræZ8 'Szvtuvy}5pʴqK&  M{wtqqv{8Alμ^4 G}yuposx~F?DmįsG(  B||wroqu{F;;@Dq̹_; >x|vqprwz9>AEwóqK( :s|wtqrv?;@I;[8 4lzxvtst3YC.9VɴsN, /b|{xvtpmWH+8jëhA!*Vv~{xtnfXP4F̼\9"&Jp}ypdZ\W@WɵwR2 >h{sicda\LgílE'2_{vrgc^Qoͼ^:'U}zxwPYhie`RoȶxQ*JtzxxxacghieSl­lD(Cl}{ydfgkjUi˺c?%<`|}{kecehll[gǶ]76Ku~| twWcbabdgh^e~ijyP:>i~ tw`_^^_ag®pI:Ys z5Z\\]\[\]]mοjQP]uGRY[YY[]^\ZYYZ[b|ξuQKbt X\ZXXY[\]\[\ZUW_j~ʹhSTcwUbXY\]YVWXYZZ[]`]TW_`iƻgTYiwUbXYZ[WTUVUTUX]cbXUVY`mȹiZXfvmTZYXWVSRSTSSUX[``\WUW\cuƸm^_gu~ UY[YWSMMOQSSUYXVX[^\XX[djrƷxbYdp|Ygb_\YUNFEHILPSVVWUYb^TW]bb`nŷ{g^amNLefca\XSKA@CCFMPRUWUYd^QW^^\WZgże[`NW[`dda]WQJCBDEGMQTRRW\_\WXXUUXX^pƼo^[X[[_cdb^YRLHFFHJMORPPVZ[[ZVRPRXXZ_rƽm[$Z\[]bdca]XSNIFKNLKJOSPQXZXQLQUUVWWazƾ^`]\[\]_ceddb]WRIDILIGEJOMOVVRMLQRNSZUWd~ZS]__\_cffeed`ZRHAEGFDDEGKPTQJLNOLGQ]WRUe\]^__^^aeecdca[RJDDEDEFFGIJIKNRRKIJRWOLU_kSY]]_\^ddbba`[SNKHEEFHGFFEAGQUSJHNPOIJW\\nXY]]Y[__]Y[acda_][XWUPKHFDBAACGKMMLLKHFMRR[lZ[^^XY]\YUW^bdb_^][[ZUOJGDBBADHIHHILLHDCNSLKOS]q]]`_[YXWUQS[`bbca\ZXUQLIGGHGFDCBFIJHDDGMNDGRUY^p[[]\YWWVQPVZ]`cb_ZXWWUMIGGFECDEFFCBCEHGFHMUSQQ]tXXWUUWYYSOPSW^a_\WVW[YOIGEDCCDFIFB==CFG@@NUUOJLQ[wWWVUSSTVVRQSSUY\\ZXY\_]RKHFDBA?@BA?>?BBCFKLJKNORUd}WWUSRRSSRRSUUTVXYYX[^`^UOJGDB@>=<=>?@@FIFDBIQQTYdWWUSTUTSRRTVVUUVWWY[\\ZTLFCBAA?==>>?BEGFABFKNIJSTUjVSRUTQONORVWUTTVWYXVTSUSNJFEEC@<<==>@CEDB@CIKLGHSTQYmTSPPSQKHHJOUWVTSUX[WOJHJNROKLJE?::;>BEC@??CGJKJHJRUVPXzRQLJNNKHGJOWZZYVVPJGGLQWQJKIC?==>@AB?;;EMPLEFJPRNMOOPQhPOKHGFEEGKOTXZXUPNOONHGLSXRJJHEB@?@A@BDHJHD@ELNKEGNRSKWvNNMJGC@ADHKNRUQNKKMPPHDHNTQLKLMIDA?ABBEGGEA?>DIHEBELOOIM]KKLJFB>=>ACFKNNLJIHJLFCCHNNLKLNJEEFCBCB@@?@BBA?@HJIECIKKmLLNMHD@>=>@BEHIJHFCFIEBBFLLKKMLJJIFCB@>>??@BAABELKFBCMMH]NORRLHDA@??@AEFFC@BECBDHLLKJJLNQNJHE@@A@@?AEKONICFKQQNSdTTSPLGDA?<:;>ADDCBABDHLNLKLNPMKJGB@@?==>BFJKJGDGJJMTQTzYXVTSPMHD?;68=:;=AEEFGGFFBHWRMdZYVSRTVPHB=::<=>ADGGEEDCAALUOJHMSRPRPJD>;:==?AEIIEB?>ESSPSf[[WTSVXSKEA?>>;:;?CCDCAAKSMHFLUSQUTMF@;:>><;=AEHFC?=?EMPPKSs]\YWWURPMIGFD@9436:<=@A@ACGIFDDLUQOUTNHC@>==<=@DEB@>?AFGFHLKNUvXXYYVSOPQOMJHD>8668:;>?=>BCCDJQPNOMIFDB@=<<>@CC@?@CEGE@CJKJF`OPWXRONRUTQLJID@=;::;==9;@@?BDDHMNLFCCDEDB><=>?@@ADGHEA<:98769=>?ACEIKID@@CGJHECA?@A@ADDCBA@@ACEDFINWIJMNKLMLKNONKGCAA@><96457:=??BFIIC>=?CIOKHGDBB@AED@>=>BFEA@DMLFHHGILNNMKKIEB@><98778:<=<<=?DGGC>ADDGBBABDHLOOPOMIECA?=;987788<::==?DEC@?CC?AJ88;<<>BHLOQRTTQMLIFC@?>;986559?BBAAEEBDHKJCAA>:;;>BM;"t]0U8oH7!S!z!G"/# T#2#f$ A$6~&y&-j&#s(-})!g*l+ )_, *z, J- N/ 5o09~2H2/Z4D5*a7h9z9;ͥдҎ`C[;3;Ut-1@Tm,06?Lg-/258E[x-/00.3?Up-//..2:BPd./.--058=FZw//-,,.3453;Mg--,/34302;H\x,,-..03431014=Sm,+-/1121/-/3:Ha,,-//011/,,.07E\z,.--,,-/00/-,-265K^u41/./01001221.--,**--,-.146?Ncx2/../0.-/0331/.,-/.,**./.--1203:CPc{20//./10//0221/.-.00.,+.//-,/0--03:FYs53211244321232100110/.--,+,-../4868@Zz7521123443310013310/.-,,.68.'%9S`n;521123553/-025542121..-./78)#16CZm|E6220./0123320/1344322320//00235/$%)5@KZlV<6431../12112234322420012460%  !'/=TmoJ=76421123113443124541.-.134) !  #)5EYwfL<965312211356544332234420./120$   #)0;StbD<7531//013566532232113453342,! $%'+-,5Hl체찲ړԦᶴ񔕘핖𳱮򜝞鴲䞟궴嗙̳ﴳ󑓖矠񟠣ѵᶴ𞟡񏎎šޟ򓑐Ҟ碦“ޔš򡢣ܔ󕗘㱰ڔߒލxؔ\p䢞ΎCUn7?Tj|42>N`rΒ968>K[o}ܡע?>87:97659DSftGGB?>;7325?P_nzIJHEC?963.0;IYiv֋HFGGEA<:71048@Qan|򜛚ύGDFGECA=:74201=KYizŗHGGFEFGA;:853204ARgxIIHB<<:531++3@Oas䑏JKKJGB>>;40.-.026EYm덐JHIIHEA>;7300/..6DVi|㕔IFFGHJHE@=;84321/./5@QgyHIGFGIKJHHFC>72021--.2:HXiyͷFJHGHJLLKLKIB:4132.-,*,3>N`q{뚞FGHIIKLLKJJE>:752/.-++,07DTcp|FEGIJKLLJKGA?<9511.+)),2:FUfqwz{}~GDEGKLKKIKHDB@>:5562-*)*((,6IZirwwy|ECFIKKIJLKJJHFDB@=87641.,+)(*/7BO[fnsux{CCGJKJHJLLJGFGECC@<865420.--./-07CQ`hlpu{EEGJKKJIGCBCFIJHB=964330.//-,,09HVbjptx{EFGGIJIHGGFB@AEIKJFB=974563//0.*),8DP[ekosx|CFDCDEDCCFGEDCABEHHEB?;76730./430..123BU]chnu{񜚖@DBADDCBBEGGC@DGHGEDA:8730/054122/*$.?GNW_hr{=A@AEFDBADGHJKEBEGGFEFD=96300242045.%!*08BLVdpz@<>ACDC@>ACEFFEDCCDB@A@>95212242%$%)/5;DO^lw}G:=@ABB><>ACCEDA@B@==>;54432464,! $&(,4DTeqy|}~zV><>@AA?=>@DFGEBAABA@AA?=976788:;2'! !$&&).3;GZnx|}~~~{xiPC=?@B@>=?CFGDAABCDDBA?=:89:9;@CA><=@ABA@AAEIDAA@?;9::788*&(()*+0:Skw|{zyvtt~}݁~~}|zwtrnkkigeddba__^^__adcbcfijkosvxy~}䀁~||}}{wsokiihfeecbba_^^\\_ca`cfhjknqvxx~~Ȃ~}}{yzxuqlighgeeda_``_``\Z[]a__dffhknqtvw~~݂~}}zwvutpljiihfeda_``_aa][[]__dfeglnqsuv|~Є|{zxtrtrpoomjgffecba`bc`^_^^_acddhmoqstuy}}|{zvtuusspmihggecbdfcaba`bddejoppqrsux~󆇈}}{zxwwvtqoljhhigfefhfeeffghffkqpoppqnsx||}~~腄~~~}{zywtqnkjjihffgghiighihhlqrqqrhnruwy}}~~|yvspmijlifcdgffhjlkgijjkknqttstfknqsw{}~ށ~{xtqpmiijgdabdeffimlijlmnmptvvuuimmnqtx{|ǃ~{wspnlhffdb__`bddfkljlnoonquvvuuvrrpnoquwz}Ʌ|vqnmkfcaa`]\\_ccdhjklmoonprttstwusqpoprtvy|~퇆~zuplkjgc`_^]]_bcefhklmnnprssqswurrqooqqrux{}zvtokjihfb^]_`_`aefegkllmmoprssqswwtsqppqststwz}yusoljhgeca`aa``adedfjkkmnpqrssruyyvtrppqtvsrsvz}yuroljhedccba``acddfjjmoqrrstuw{{zvsrportsqprvz}}yuqnmjheddcb_`bdfeefhihimprrsuxz{}{xuspmorsrpqswz|~|{vpmljgeddba`aeggedfghhimpqrrsuy{}}{zwrommptvtrqtvwz~~~}}wolkigccaceihfcbbdgijlnoprrsw{}{zxtqoopstsrqrrsvy}~|z{||{zvpmkjgddecbdfhgda``cgjkkmoqrqrvz~~{zywtrrqpqrponnrwyzzxuwzzxutromkhefgecdefdb`__chjkklpqqpquy}~|{yxvtrrpnoqpommopqtvwvuwyvttsrqnkhefhdaaceeca__bfikmoqqpquy}~|{ywusrpmmoppnnpomprstuwwtrrqokgdegc__adeda``begjnpqqpqtx||{ywvuspmkjnrqrspnlmnqtvvusppqpnlieca``^`ccbaacddfimooqsqqtwx|{ywvuspkihlprssqnkjjlopqqpnnonmifca_``^^aa``accehjkmoqppsuv}{{yvutrnihikmoqrrplihgghijklmlljea``]_`aegffiklnoqrtuzz|zwusrpkiijkmoqqpnmkhdcdefhiigb``__^_^_adfdegikmnopshqvy{zxursrnlkjjkmqpoqqojecbbdefdb``_]]_`_]]^]^acddefhjlmmoq\bmuxyyvrrnkklonnpqomjhecbccb_]\^_^\_bcb`__]^`ababdfghikllmo`\dkptwusrstvvqmllmmnoolieddb`][\]^]\adca`_^]^aa`_`dfgghkllowd\\dkqrrsuvronmllklmprpmigfc`^^`_]]^ab_\[Z[\\]\[\_cefghkmklq~j]Z]dhlnpprsqoonmmlnpqomjhhebbcb^]^__[XWXZ[\[ZZ\_bdfhjlmlnrlXQU[bfjlnoonoopomlkjiihffec`^]][WUUWZ[[YZ\_abcfjnmmoqtl[QQU\chkmopssrqoomkihhgfedbaa`_\ZYXY[\[ZZ\`cdcdfjnnoqsuq]ROU[bfjnruvuroomljhffggfedc``bb`][[\\]][ZZ^cefddfimoqrtvſhVRRW\cjptvusonmlkkjhgfedcddbbcb`^]]\ZZYZ[]_abbcfkopqqtyj\TRU[cjpstsqpnlkllkhfdccefdcca`^^\YWWXYZ\^`abdhloqrruzûtbVQSZbhnqssrqmlmmlkhdcdfgdba`_]\]\YVUWXZ\_bdceiloqsuxz|j[RSW^fmqttrnllkieddeec`^^]\]\ZXXY[]_adeeglnoqsvy{½o[RPU\emrsrnlkkjgeecba_\\]\\]\[[\]^`bceffinoopswz}ĿvcUOPXbkoomkijkkihfdccb_^^\\[\^_`bbcefgimnopsx{ydTMOWahkljgikkjigfddca``^\\[]_abbcefgikmpruz~hVLMU_gihfhjjighigea``bca_^]\]^`abceddgiknsvz~~k[SRX_efeffgfegihfa^_bdb`_^^`abdedehjmqvz~¾xfWTW_dec`abdfghgc__`cca_^__adeddfjnrvz|zi]XZ^aa_^_abcegedeedb`]\\]^affegjmqux|ř~nb[Z^__\\^^]adfhjifb^\[Z[]_bfggjnqtx{~xkb\ZZ[\^]Z\`bceffdba_^adccgkmpuy|~zmc]ZZ[][WXZ\^_acddcbehfdcgmorw{~{si`YWYWTSTWYZ[\^accbdffehmpsx{}~}}{½vmd]ZVSPPQSVXY[^abbceefimqtx{}~|{yvuj_XUQNMNSUWY[^`bdedceinqtw{~~{yur¿tha]WSSQOPRUX\_adeccfjnqtx{||{yvsqtnjc^]XOMMPTY]_bcbcfjmprwzyywwvsrp¿|{vph_UMHJNQVZ\_bdegjklpsutsrqpnl¿vmbXPNNQUX[addeghikmoponmljfvlc\UPORVZ^abceghhijjkkif`ӿytrnh_ZXYZ[\^`begfeefhhfa[¿༹ru}}tlgb^\[\]_accbaacda\W{sjrzskeb^ZZ[\\]]\[[ZXUdqdbm}|smd\WUUVWWVUTUUTRi沫h[[es}sh]URQQPQQSTTKV~j^]ahoux|xl`VPNMMNOPRMPfθulf`[YY[aksz~t_ROMLKJJKNֶջеaP<} ࿑\@E[ tJ8B_" ߞX=6?[~ ي=57;Qs t*-7=Lesө] (6@IX󡠤njM!'2?=;C]͵V! 1==;=CPoçxH &5<:77@EOaįvC(685/18<@DKW{νk:!.8:8349=::;=>>AIfü±~Y0 09>?<67;;w@?=::<=>>?BK_pE)"-:??=;:<@A@?>?FWɽj?%'2=?=<;;=@AA>=?BP~Źb8!,8@?<==<<=?@>=?@Kw[22>CB?=<;:9>@=EkȽ|S-"7BFEA<::88>A=;>=A_ĺrK*!&:EHFA:778;?A=APpZ8"!,>HJF?<::879<<>@AEPm¾~O2"&1BIJFBD@6106;=>?>AHc¾tF-$+8EJIGEJC,$(09=>=;;?Yj=)%0=GJHHG7'07;<::;T_6&&4AHIGIH=) %/8==<9O¾wT1%(7CGHFIF/ '5BEB7I½gF+%-;EHJJI>!  ,O¿vS5%"3EKMM@)"9?TýbB*#5GKKJ<$3>SzrQ5!&8IKJI9/>Tz讞aA)*;JKIG5  ,=V|岯lN4!2AJLH=, 'GHD9% /:KkƼa='%5CGD=1 06EdżƯrQ1 !2@HF>6+ *2A]Ĺþ讯󭫧שּׂ﫭䩫򦨩򦨩jRJL 夣rL9D] 泌衟\=2C` ⯰}F20@[| حn1,1:Rp Ȩ[!%/8Ke쨭G-6EZxޭl9*3?Pp򎑖򮬪-T-'0:Hh>$%,4Aas/ &+2>\z}}e& ',4@Yt~yvwz~R(/7BUmxw~ywvy{{}i<)2:CSguqyzvxz|{yy{ѭI" )09DSfyt{|xy{xvwxxzs0 ).7BQcz{~~z{{urvwvuxX" *.4GNZg]Rktoojfggf`\esзtdW?% -/,*)-29BKQZdYNe~zuldda]\cpĶqcW=" #0/*'',2;DMS[dXLaz~ricbb`_^aht͸znbU:(2/*'(+2;DMT[cYM^t{ngdaabbabiwvk_P5+440+)-17BLSY_YRYiy}vokedhhfdejwsh[J0 "/674.+/15>HQW[YUS^{|ytkinlhfglv|ofWC*%2984.-146:AMUZXTJT|}{soolhdchq~yndS:$)5;83/05658?JT[ZTGQysqmhb_bitwncN1-8<72149728AIT_\THS}urmga\[_j}yunaI*"19;7369:5/7BLV_]TEL}wrle^ZY]f}xtsm]D%'4::65=>5.*3@MW]\U@Dv}|>wpib[XZ_f~xusrjW= -69768F@!!)6IV[ZS=Atypieb\YY^gyutsoeO6$28968=F9 *?OVYU<>q~ulfcb^ZZ^f|wtsrj\E.'3898@D:' 0@OYZ>;k~wohec_\\^a~yvusocQ:&*58;=DC,  /AS]ACD;  /I[D?h(~vrja]ZXWZ}yvuuvpdN8%'18EH5  5I@Ba{plf`\YUV\ytstvuqdP7".6;??9&  ,>?Ieymgdb_\]\[zusstvtkZD, 17;?:.  $6@Ndznfcc`_``^|vsrrsvpaN9#$47:>9*  1AP^z~sjdaa_ae}xusrstulXD/(78:A9&  -@Q]zxqjdcb_`b}yvusrstrgO:& ,99:C9" +=O_|~{xqida`^\}{yvsqqsrk[B. #099<2 (8HYy~{yztlea_][yyxuqqspcO6$ *48;94*  (5CTv}yy{vme_]\\wwtqprutmZD, 068@?.#  )8FTt{{~xnb[[\_utrpqtvrfP9$&478@='  *9FRr~}~wkaZ[]`sqqrtvvm]E0%/67694!  )8DLn~|sg`]^__z||}|{{zvoidcdhknqsrrsuvvuuvtrlHz{yy{|{{zvnheegmpprtsrrtwwvuuwxxuz}yxzzyxxtliijlnortsrqsuutssttusz|ywxyyxwvsljllmoqssrqrttsrqqo]UwxwwxyzzyyupmmnmnoqrtuttsrqqnUUuwwxyzzywsqpnnopqqtutstssrqm3twxxy{{zyxvusommoqqpsusrsrqpng3twxyy{|}}{yvtsqppoptvutupkijvg_kuwxz{|}}zvtssrponosvvwwk`afyn_SKCNRNIDU uvy{z{{~}{xvssrqpnlortxzeQTay~p]ONNOPMG/U w{|zz{}}{zxutsrromnqsy|]@EXvwcQPPRRPKGIJKOVTyz}}{{|}}|{zzyvsrrtrprtv{zS/4JonWSSQKHILPSUTz}~}}~~}||{wtssutrux{yoE")Afv^TPPOJGHJLOSX^ccWQWtX{~~}~}zwussuttx{u^6$<]z~gTJKKIHHJMQV[``WSSUR X}~|{zytqqrtwz}oN.#9XwsVHHGGIKJJKKLOSXZXTPRSTVY\~‚~}{xwvrnnoqty|~g?'$7Ts\IGEDINMLKIGHKRVWUQPOQTVWXXWW|}‚}|yvutpnnquwy{|z^2# $4QofPJFEILNMJGDDFIOVXUKGKPTVXXWW|||{xurpooptxyz{yrR%#2MjpXMHFGHJIFCA@ACIQXXMGJMPRTTS~~{zwrolnquxz{{|veB!3HezaRJFCBDC@><<>ADHSZSNJIJLMNNO~|}~}}~{xwuqnmqvy{||{|rW5 1DchWKD?=@A>==>@AAJSVSMGDFHHIK|zzwusrqppw||}~}{zkG( /Aao\ND<:@A>>?ABA?=AITVPH@BDBCF~|zyzyxuspoqsv{~zt^1  0A_xaRIA=BCBA@@?@?=<@LSSNGEDBBD}|zyzyvsqoosw{}wjN "2D`gYRHBCCBA><>><9:FPVTNIEBBDxwxyzxtqppsw{~zpY; $7Lgpe`SG@=?AA<:;;:9?@=;<;98:BLY[WOIECDtsttrprvxz|~|vjW8  *>Riue`]VH@>==?@?><88?ITYZTMGEEtssrqqruy|~zo^I, 0EXmzha`\LB><=@A??A=;;::BKSWVOJGrstsrty|~zn\H4 .:I\l{n[YZUK>98;==?B@>;;?ENVXOIGqsuvux|~}ugS@- 7?K]kxsVTVVNA979<=>><>AGRXSMGstvxz|~{o_L:(  %?EPcoyzURTTOE=7:==<:;;:;??@JTZVIttwz}|tgXE4$*AGQbp~WTWSPMD;::979:9;>==GR][Mtuy|‚wk_P@/.@FO^pZY[RQTLA95665789:<<>GQ]]Svx{~uhZK;*  1@EN_q_\]RPUPF;43214789;FOX_}|zuhYK@7'  -?MQYfzƣr[OMLKOSNE:5533675449@GR]}‚}{voaSG>6$1EUZ`j}ȫ^MPOJOVWQB;86554112684221/02359BOЂzsldYNE=4! (=N\bhrdzgLQK?AJSTJA9300120/2:H΀}{wph_TIA:1  /AOZajwƶkNQJ=@IQTME=9532330/29E}xwsld[OE?8. $5COZbm{ŸmNPJ=?FMPNIC?<867631039B}zvtog_WLC@8* &7EQ]gr}¸kKOK@>?BGONHD@=;<842127>~}{xvtpi`YRJC@6% *:GUclvjJPMB>=@GPRNIC?=;8520028}xusrpiaXRNID@3 0?IZipz·kKRNC??FNSUTNF@;8761-+-2~xspnkd\SNKHC=/ 6CJXfp}»nKPLA=>IQSUVQJB<964-*+-1}xsnid^WOLJGA9* %=HJUbqtMNJA<=IRSTTPJB=;61+(,/2~}zupjd^XRMKJF@4% 1CKNWe}}]ZkzRQNICAFLSQJGD?<:73.,.02|xxvqke^XSOLKJF>/ ';FKO[kp6+Aa~WSQPICCHQPGC?=:8640..02wssqkf`ZUROLLKF;* +=DHK_qsW 6Y}}XRSWMABFNQNG?;8642/../1spolf`ZTONNMMJB5$ /@DHOhv\72Yy}YQS[PCCGLNMIC>9630/-,,/pnlhb[SMJJLOMG<. !5CFMZrwA2Vz~YOR]SFGIKJHJJC<840.,)),nlhc]VPKILNOLD5'*:FJ[rxh0 ?h]LN\THILMNOOKA;951/.**-lgd_WRNKJNONI?/  1?JQhxU& /XeLK\UJLNNRVRJ>896210,,.f_^ZRMJIJNOLE:)#6CNYomE 'IrqRN_ZQQOIMURJ=6765310.,`YXUOKHIKMLH?2#';GTewf?$ ">f|XQa[PPNHJQPK=66543210-[USQMKJLMKG@6(-AL[ufF3# 7]^UdWGIKJJMKA963012002WSQNLJJKJHB;/!!2EQcgJ;+  0V~`WeWFGJMKFHIC?;6233102TSPMKJJIGD>5) &7IXmhNA1 )Py`XfYIHKQMDDEECA<76531/SROLIIKJGA8,"*?=94100/RNIEFHLKE;.#7G\xndVA# )KpVNc`VNKQROJD?<><82/121PMHEFHKH@5("/?SjysjY@! (PzXNc`VNKPRRNG?;<:620232NMKIHHIB8-"-AEKONLIIJDBEEHKNQSUWUUWSMNRVWQLMJIFE@>>@EJNPPNLKGDCCEEGIKMNPPOPTSQQPNMGAF@ EDA?>@FILPSSQME@CEFEDEGHIJIIGINQSQONNPOLF@CJKWVL@ DCA?=?CEGMPQPMGCFFB@?BEHHECCEFJMKIMPROIB>@DKQV@ CA@?<=@DGHGDABBADIHGMQSOICABEKQWXV\B>==;:9;>DINRRKECBBA@BDGHGGEDB>BIJKNPRPLHGGILQWYZ:\D>??=;:;>BGKOQKEBABA?@BEFEEB@?BHIILMNMJIIJKJMPRU[aeifHACC@>>ADGJLIDA@A?=<>BCBBA>>ADFEDHJJHFGILKGFHLR[`cbZSfMCA@?><=;::>ACEEA>@AA?==>?AA>;=@CCABDHLNMJHGFD@?@CGKS]^^bgecaXLA?ADEEDEILONKIGGFDA>ACCL[`bccb`V[RE>@A@<9;?ABBDFEDEEDBABDCAABDECCGJLLJJIFA>BC@HW`dedaacb]TZVKB@>=;;<=??EIEEIIGDBBDECA?@A??BEGGHLPOLFA?DFAGS]ehf^_dc_]X[QGA=::;;<>=;@C@AEFFB@ABCDEECBAA??ACEDDKQRNFB@ACCGOW^ee]^cddbalU^XND=89;::<;9:;;<>BD@>ACEEFEDBAABECBIOQNGCA>?DHKOU_c__bdecadS]\UJA:9976899:;;?DCBBCEGGFDB@?@A?@DDCGKNMIEA@@DFHJNW^bcbaabaaOZ^[OF>:85457988;;:>DFFGIJFB>=>@A@@CEFHJJKKGBBCBCFGJQZcec`_abaIU^^SKE@<865686469<@DFJQQKLLD?=>ABCDCBDHKLIIKHEED>?DEGMU`eeb_accDQ\_YSLD>:86785236;>AEKSTPONFA?@BCCED@BFKLGGKKJIE?@EFGJQ\cgdaabc?NY`a\SH?;:9963248;=CIOSTRPKGDCBBCCB>?BHKEFKOPLGDDGHIHLW`gfcaac;HYcd_UKC@=88963138;>CIPTURNKHFDDCCDCAADIKFFKPTPKGDCDGHMV_eeb_`c8BWef`VOIF@97962139?CHOX_cba_`c7@Q_ff_WPJD>;94037<>@ELRUUQNMKHFDAAGIHGFGIJKMPQPKB>?>?GPZ^`deedc6>KYehc[SLFB=9316:<=>DJORSPMLKJFC@@FIJHGFGJLNNLG?=@=>GPX\^cghea4;HU`ecYOKHB<767::89;?DIMPMIGHKHA?@BFJJIHHJNMJFCB@>=?GMQV\adeb]28BMY`cZOMID>9:;;9669<@DILKGFHLH@>>ADGHGHHIKONKEBCA>>@DHKS\_aee`17>=:6469:=BFJJIIJLHA=9657;>BFJNMLMLJFB>LYc_YVRLGCA>9679ACEGNUXZ\`g048?IT^`]WQKGE@<:769?CHMQUQLIJPNGDBAABCDHIGGJIFBAA@==?BCBHRX[]ag3349DNW\^XQIDA>;866;BCEKNPNLKLPOJGFFDBDILLHFFHJHD><=<<977;ADGKNNOQSQLJHFDBCFJKGFGKNJE=;=;;@@<@HR[`cd0349ENT\`^VHCCA>;99;>DIMNNOQTVVSNKGDBBAAEGDFKPQKD><=;:AB<>DMW_dg.038?IV_dc[MIJHD>;;<=@EKOORTUUSOHB@?@AABDFIMQRMGC@>97=?<=BJS\cg..269EVagg`SONJE?=??=>BJOQTUSRRQOF?==>@CABHLMPRNJGB=87:<<=@FNX`f/.04:DR]eieYRLC==?z<66UU4U5¾93o*C1cE&C1ÿoR6).];0$.kA3+%,~K6,&,a?,# %%3*zK," $$.V.# !#)-f:% $'15**(|O+ #%'"II(a1  's;$!*K* )¿¿]4!#&[[$êqD#!()\\$ŵY- &()#ǽr<"#'.3#=>=?z<U6U6UU4U5S3oKn1kZEn1rbRLJ*.|hVPK*.򟝚pWJ@8$.,񢞙{ZG=6.*.,𡞙fL:/+123*uT:,)026\-]>+',2=A-餟jI0')-359!UU(饡z\:*&%(09+(쨤hC.&""*158'몦sL4( %+3D*ꩥX;)!!&.4@)姥dD," !(-6B}}$妧oN0%! &25~~$襧}]:*""/3A3#袞oI1#+1@G3#]=]>f=f?\z`O<a^ZeqU6caaeqU6ba`aUU4b_``]U5`]]^a3_Z[]dpx1^Z[_iw/][Z^gu.[XY_o.]\WUXg~},b]VQR]q},c`XSQXh*caZURVau-e`ZVTW_m(e_YVWY]gwq(c_XUZ\]am(db[X[\Z[d'gf`[\ZWV^y*gd_\]ZWYaqU%fc`^^[WZbi{$edb_[VX\aq$ceec`[WW[]k#acbaa]WY]\f}# 3<t%;o;P := 9|)9^% 5̠l6 5~>3գQ3c) 1q2 0 ÍT/ O . F- ӎ>+ ۋA++J*K )܉+ (n#(J'}(&ȳ񲴵Ȣࢣ¿떗᠞謹Þã餡ǵܼ¹⵳㵲涱ڰɸٶ߯豶ﭬҬ򯮬¿¼Ľ䰴𦮯û޸͟»򦤥誩边úľᥨꠡĿաļļúǿ½ԫ¿ýĬļqrstx~~{wspnmpty{|}|~|uooswywtpptz~{xw{ssux|~{zxwspoquxz{~x{|womsvwtqmpx|}ury{zxxwwy}}{zvqoptvvwy~x|~zpkortsrtvyyxvw}yqzzxxy{~}|}~}{wsqrvwussv{|x|}tnpqsrswyyxw{~}wmyxvuvxzyy|}~{xvwxzzwqliltwxy||yxvusstuwz}ytrwwutvxzyy|~~zxwyyzxqjdciouwz|ywtssrsvy|~uswvvuuwz{{z|~{yxwwuwxrkebbiqv{~{wtsrrstuvwwvqt{xxusttuttwyz{|~~yustuvqmmlklorvz~~|zxwvusqqrrpoptww~}wsrpmllortuwwxz{|ꂄ|uruvuqosutqnnptx{{zyzzxtpopomknxyryvqjgfiknnoqwz{|zz{zvsrrpljjmrxzyyz}}{yupmnprqszwn}ulgegilkjknuyz}~}|yuqpqokgefjrvy{|~}{ywsqqrssuyvo}rljkmnmllnuwwxz{|{~}yvtrqpnkgb]_gpy~|zyxxzzwsnorvxwxsonopnkknrsrtwyz{|}~|zwvtrolid]\_is||{{|}}|zuoopswzytqppmijlnmlpuwz~}z|{yvromjc^\blv}}~}{zwsqqptyzvrnifhjihgimsx}}}|ywusof`]`gry||{|}||{ywurmov{vnhdgifeedgnv|}zyxwsjdabfmtxyxxy{|}}|zummt|yungikjhecdmu|~|wttvuokiggjptwvvz~zppv~}{tmlkjhddekqvz~}|~}xsqqtuspljhddjotrquz}vtw{tojhebdhjklnpsx~zvrpprssplkjdbgkmjilry}~}zw~|zwrmhcdffhjmpu{wtromqvtqonnmkhfhgfdcglrvy|}xڄz{~}umgedabfjnpsxzwutqpponu{vollpommje`^_ehinty}~{{|{sjfedcaejmnppoprtvw|ysoptsrrpmid^[_a_gs{~~zqkhgfbdijihhkllorw{|xttwvvuspmh`[^^Zbox~|unjjllkgcaaehklou{}}|{zywvwvrolfbdc^afls{{tompnjd`^`dgiknu{~~~~zwuvuspnifhhd``dkvzuqplhc_`bfggjnuz|~zwttsrpnjhjkib[_gqz}ytqoidbbeffiovzy|~{zz{zvspljkkib[[_fnwzxwqjdbeehmuwux|{||~{vsommkic][Z\cm~|tlffiihgilmmquvx~~~{xvsoliebb`ac؅woihmlifefghmrrt|~{xxwsokhfhhd`]~~׀}tljnmieceghnspq{~{wstwwupkgiid_ZÌ|rnolgbaehikmlnx|{|~~yustvyxsojkjgc_}|Ԍ{tpjd`agjjhegluvruz~~xwxvuxyvsomlkjh}|~|skfbadfhfdfinnlpu|~{z{yxyzyvrrsqppyy{}~}{|zrkgdcdggffgiilqz}|z{{|xtvwutrwwxy|uoljjgjklloy~}}||~zvvuqk{zwuuw|~ↂxspommkhfhijjmw~~}~|xwvvqi}xuttz|{}}~ȁyvspmkhecbcfkt{}~~}~}{zywto|xvux{|zwx{|~ށ}z|xrmkjheda_afnuz{z}~}zw}{yxwvusuz|~{|wy~zpighgffc^^bgmsuw|}zvqsxz}|z}z|~~rheeba`aceglosvyׅzsrux{}~~{z~||~{|wkeceecbccbcejnoqy~wrqvzz{yy~yxy~~}tjdfjljfb__`diknuz{}}wsvxvvyxw{|xxz~qghkmlhb^_`^biknsvvyˌ}xvtqsxvsux{||{nkjiigc`cc`dloqrrpv~Ҙzvrnotrpv{~xrnljhggebdhkllr{}}{|~}xsnnpopxztrnklmkheddeghhiow{{wx|xtstuw|~||~}xtpnmlkifefhlnnoqsuux}}yvtvyzzwx{vw~}xtqnoolifgioqomknqvz~zrlmprtuuv{{xz~zuuvsnjggimmjhhlqz~~ߑvnlnmnprtx|~{z}zxxuojghjkjiikpy~~urojhlosux|~~}~{ywsnjhjkhhkllov|~}wqljnpqppsvz{{}|xtqnjghhefkllknv{~}upnrqnljknuxxy|}xspolihfcdikknuz{}{z~uprojjkiluxy{~{vtssqlgeeiijnuwu||zw}urmhjlkmtwxz||xxvqkhgijjlosrn~~x}umhjnopqrsuw{}~}{wtrljklnrrnjf~|{}slnqtsnlnqu{}ywvrpoopqpjfczx|~|rruxtkghmt{}zyxwtsqomhedyz|yusrokhghmv~}{xusrqpolgpr~}ysmjkiedfox~|ywvuutpkqs}~~|}|ohhea_agpy|{{}~~~{xsomtv||}~z~~xmga\[]`itwvy{~~{upmyz}}y~}xx|yg]XX[[boqry|}}{un568:;=AEJMPSUTPLKIHFCB@=;:7447=@AABFHGEBFFA@@>;:<<;@FB>>AG668:;=@CFIMQRRNKIIHFDB@?=9546;=??AEIKE=?BA@@?;;AA>=<<=AF?;?@>8878:<=@CEGIKLLKJIHIGB@A=9559;<<=BGIC;>ACB@AA:7:<<;@>=A>9::879;<=?BCCDFJMMLKKMLECB?<76:;;::>BE@;=AEEBCB;88:;;<=?@A=7=<989;=<=AB@@CINONLMNONKGB>;:;>>=:89;?><>ADFGEB@@?=<ACA=:>=:89;==>AA>=>DIMMNPNMKF@<;<>??=:87789:=@CFIGCCBA@><<>?==>@A>=>>:89:=@A@><::=BGJLNOLHFB><;<==;9852259>BEHHFCA?>><:;<==<<:=C?>;99:=?=;;=?BDEHJJIHFC@><;;:867522369=ADDCBA??<::<=<::>AEHJJIHEB=::986577533457;??@A@@?<::<=;88:>@AHGEA>:77622788:<<;?DGHFGHIGA==<<;9879622358==BCCACGHGC@?>>=<::;722149::=?AA@=;;<;977:;;NNJGD>877668779;>>=>?=;;<=?>;6231-.369:<=>>=<@A?;7669<@MLIFD@<:988988:<>>=>?<;=>>?BCB?<=>@?;7454//148;=>>@CDDA=9889=BJJHFDCB>:99:989;==<=>>?A?;>ADEC@>?@@>;989852138>A@??EIFCA?=<;:=BJJKLKHEA>:7545799:;<>@@BDEDCA@ABB@==??=62038?BB@?ACA@@>=;8:>JJLORPKIEA<6312466567:=?BDFFDCBBCEDB>@CC?72137=<<>@AA@=88;KKMOOMIFB?<:6223564339=@CDEEBAACEGGDA>?AA?:7764458:;<=>@DFGEB;:>:544775339=?@@BCCDEFFEB?==>?><::7400479:;;>DGGD><=RRPKHEFGCAA>:8899766:;:99=BEGIHFB>==<;>?=;887216886558?BCDDB@>SSPMKIHJJEA?=<;:9854467558;?BCCA=:99<<=<;:9864355455459=<96223448:;;:867:=?<989:8566421464226;@DGEAMLLNOPOLHD??B@><932342./345689889:89=:98654321/.4<@BBAHHKNOOMKJGDDEB?@=8664..34456779;:;=??=;9<@@?<:987310.-3;>?>@CGHKMMLJIIJJHC@BCB>964331013456899;>=;;<<=?@@>;87742321248:<@EFFILOMJIILMMLIEBCEFB;76640../145567:=?><<=??>>??<877545563137;@EEGKQQNLLPPNKIGEDDFB<9884.,,.144335;>?@A?>BA=<=94/-/255346;>=@B@@BA>?ADD>;::97741136:>GGIIFIOPQTRKHHKNPQOMIFDB?;4/2465458;<;=A@@BA?BEHGB?=>=964322039CDGHDFKNPTSMIFIKKJJKLLJFA<6246775789:;??9677864003?@DEBDHLOQQNJFHJGGHKNOMHD?9567742357789=CDA@>==>>=??;9::;851/1==>?@CHLNLKLJHJKIIMPQOLIFD>96554221235788;CFDA>>=<;:<;:85223??@CFHIGGIHGJKJKNQRNJIJJD>:873//02345758?BA?=??>=<<=??=;:85334DDCBBCBCEFFIKJKNQRLIIMPKD@=:4--/2334434:;9:=@BBA><>><;:85346BBCCB@ACFHIGFKMIINOOHEEJQOKHC<61//00232378679?DFEDB@?>><:87568>?ACC@=@CGJKIFKLGHNNKFBBGOPONJB<7310//13235546>DHGDCC@??=:98789<<>>=<;<@EHHIHECCGMMJGEEFIHIORPG:755643347=BHE>?A>=?<889887==<99:=?CEFGGB?BFKKIHGFEEDFMSVNA<9889633212357<@EB<>@??A>:;<<:7CB?;78<@BBDCAAEGGHGDDEEJOSRLD=:99641001357:>A@>@BDFGEA@@A?;DDA=9:>??ABCDDFGDBBCFIMPSRLD>97541/001249<>=<@DHIIHGFEEC>DDCA==?><<=>@AA>?B@?CEDA>BGIKMQURKA95331010./27:;:9>DIJHIJJHEACCDDAACB?=;9;>>=>?@=ADEGLPSSOE;4221345778;?CFHIIKLKGBEEHHFFGEC@<78;;>?>;:?BBA?ABBDHLOSSJ@6212433213468:>BEFFJMLIEJKOQOLIFEFB9679;==;::>@@??BECBBEKSVQG;4146441//0/1369=?>@CIMNLIPPRSQOLJIIE<879<<;::=?A@?BEDCBEJRWUNB82464330.010147:<<:<@FJKKJTTQPNOPPNIE@=;;<::;::=@DC?ACEFGIMRVWSJ>544210024358;<:99:=ADEFGTTQNKMPOMKIE@<;;8899>BEDAADGJLLQVWUPF<86310235655699779<:8778?CDCBCEILNLJOTUUSMF?:532467754456569=@@?=>ALMOQRPLJJLLIHGC>;8789<>>@CEFGFDDFJNOQSTSI?734456764334568:<::=@LLNQVSLJKLKHKMHB=96789:9<@DFFD??CFIKMPVZPD8455"78754345677877;>ASSNLPQPNMMKIKNJD?:4235689:?DHF@>@DGIKLRWQH<668:;:88766776788;AB@RQLKOPPQQPNJKNLID=53345677;?DD@@ACEEGKQVTMC<89;:977865676779;@A@LKJKOONRVUQKKMNMJC9676655679<>@BDCB@CLRVVRLD;996545742577668;<=?GGJLNMMSXYSIFFHJIE?:788665567:>ACBAAEJORWWRI>:853346423566579:<>DEKMKJKRXYTJCABEFF?99:865546=@@DFHJNVZVNC=:64356532245578:;@CEGKPWZ[VOJD?<:98558898767IHCACFIIHEGPQNF@=AKPROI@:669<<878:==?BCCEJS[_\UMFA=:99:<:898424GF>=EIJHDBDLOOIB<658;==>BA@AFPY`_YOHD?:9:=>>;787201>>@BDFIHGHIJIHGGFIOQPMKJF@=<==9779:9<@@?AFOV[][TMID@??==<:88764289BEBCFHJMLGCCGKMQTRMGEJJGC?<::855668>??AEKPTY[XSNIECB><<;:87874:;ADCCDIMNI@@EKMIKSOHGGFHKIC934200136AHLLFIQMGGHFHMOL?630/./15;>@@?CKQV]^WPHCBCDFC><;:85<ADGLPRT[_]UJCAILJFAA@>94ׯ|[E:63100112467644332001344572(!""%)*)**(*3NqxWB832332112578665320//0236:2$ /22..0/,))+**7SꧮxX=54664213578964331//1357/#+=?>?=93/,+,*)-@krJ<77653245678634452/02455-!"4EFGMI?72/-,+*)4T{cJ;654433443345542/2554*!"$3BGKSOB:51.-,+).AcbG823323234431/14664(!-=DJOLB=83.++),4R[?1120/2443221./2685&"6?CBAA>:4.)(*)+.Fs{X>1.1//12231//18:5&)2779<81-)&&)(('6YwW:00//00/023431//2:;5'%*,04/'$#"$&&%"+Bs|Q9//10/..02330,.18;7)#&'#  !"")7jtWC710/.--.020-/38;9) !"$(1dúnI0../,)),12236;=9&!#$$&-^ߨhE6/.+)*-13357<=9& !!%O¹hI6.++-011248<=8&;iooR6+(*,..-27;<8' '@o]tM8.)),,+17:;9)"FgynM{_D1(,/047898+,?UUAeH40/146998+ &9>7mO90014;=9+  &,/sWC735>A;+ ! !&*}aF:7AC=+!! "%&鬮\D8?A:) !xXCCA:(y\NF@*!! "   zcSH.""#%$ hT7 "#$('"  xV0   #&&#   zR>/!"##! #"  $vdO:% #"!"   0|dH,  7䩥zS*"" (8{WD4%   #29ڮjF* .;:rN,  3;5vR5 (%591uV4 2772\<)  &:852lD, *>942oP8**<81({~~]D.  *98-|oI#  -::0!xm@ 0=:1$y{xM!2A9, z}K/%6A7*|{训ƹ^==>6)x}kYI9*u{}_F4'xxnR9ovwU~wyݮ||zz}xq~|{~ÿã߫}񷺾¼|bL@=@?=;;=>>?CHC?@@=;==<93&&((+?Wozxwvtsrsts`I?<;<::<<=AEA=>>?>>?AB;.!&('#$()('')&$.Bdvuutsstwv`K97:<=>><<=>BFA=>>?BDE9'$11//-*''2Vltvvuutuvs}tZ=67:=>=;;<>??BEA=>=<=?ACE8$*766:82,)(('()$(F`pwwvwwyw||}lM;359;968;?@@A@>=>=;;<=?B7& )78:A>30-*()**$%8Ojuwwxy{}ww{xbK9459858;>?>>=<:;=>?B7&!$37:?<520,*+,,))0Dcsyzz|vqv{~~y`G949879;<<:;<<;:9<@ACE7$ ,3655431-,-.00.=\p|~~rny|tuyp_H95468::978::98;@DFD6#"(,./1.+)),..*4Lezno{|klvzt\F625787657988:97:?EGE6""'*+(%%'+,++*'-BFI:#"%$$)+**),5Svwu|xsou{wvYG=5236799:=;9;>BFK:  !#*-)(()+0Nt}k{|tosvyuu{jV@46899:;<99uty|{upx{tzzkYF4269;<;9:=?CH<' '8Qb`N1vx{|xtquzyww|}q[?668::9;>>BJ?+!"! #6FL@'xxwvvurtz}~~r]K=42799;=?CH=*!!"" !%082xxuuxywtrruz{z}}o`O>4347:=@EI=+# !"! !" !$+&xxtsxxurqvyxww{tqjT?1-28>AEJ?,$  ! "#%# !#wvssutrsuyxtrs}|yy|ziUA627=AEI>+#! !!"#%$!  xvusqooswxuonry}ww|{nZG87;@DH;'"!!"$#!"$''%"~zuqmjmonlkovy{yz}|z|zr_G<8=CH:$!"" !##" !%)*'$!~xsniikgglszyx|~~yuzrYF:4&}vrpmhcbZLGJ[lv{yvstvyvooqppqpqv|wqnpssux}u\</@?3!{yurmhhcXOIP\ksuutvy{ytssqnnqyxutvvrsx~za;& 0==1{unjjihaVKIYfptvy{{|~|yvphiqy~{{||ypqzgJ15:7.!|skjknjaPFJVgrxwvy~zskkqx}|}~~~|uv}|iUJB8/'~ynllnmhZLBH[kurqw~xsqrw{z|~||xeRB7.~{smjihaWKFGTchnx}zwxz}}|}~|||p\G4~}||{rjhie_WL@ER]iu~||}~zz|~~{z{}u_D|{}|plkhdcZMFFP^mw||{zz{|zyxz~~}}d{x|~{uqnkkf\RKKR_ir~||{wwz}~||zzvy|}}~yurpnkd[NHNXfv}}|wyzy}{xz}~~ꀃwpljjhd[SLMUgwzz~~z|||{z|~~{qjggijhaTKJWgosty~uw{~}{|tnlmonkeZOKNXdnv}~}mpuy|}|}vpoponmeXKDKVbmuwxx}||dfjpx}~~}tpokjjg`WNKLR[fmrv{cfjosx|~~}|zz}ztpkhgec]XRNMQYclrx}~gkoqpqtx|}|xvxzsmhecba_\VOMPYcltz|{ww~~~~jnqssqoswz{z|~zrkhfdba`]VQOPU`kvtoot˃lorturmosw{~wqnjgdbca\WRMMUanmglt~mnpqtqmnrw}~~ztplhedb^[XUSPU`fkovmooqsqnptx|}|ztokhgeca^\XQPU^jqw|oqqtsquyyz{}}{xqlijjgd`\WRMVcovvx|~ILUjĹ|o[LB><:?J[mxiWNJJIIGHLCIKXu}kI5*('"#,E_s~u`OHHIIFGL?HLUc{{t^;,))')5IjpVJHIJIJL=EJOVg~~wmU3*,,-0.*,;d~aQJIKLMO=@?COWa~vjS5-.,,31+,:bo[LGIORS>>BFJNVgzwjQ=/-,+*,5Gf}kQMOSUV>9@C>>BHTkyzteVJC=78BTi{t[TRTVV<9AB86;@GSh|vxwsoh^UNR`w|fZUVVS<=@?9@><<@E@>HR\p{pggouywyrbWVPDAA<:=??;:ENU\h|vojgedeipyᒇxeXSJ;A=::@@==?FJJMTlĭ{vwuqlfccfmv~zhYPC1>89:?DDA?=9>=@EJPVdy|{vtmgghkpqqpoopol`I0=>??=:;;:>?@>;:99><=A@;::<=?@@DGEEGMWdtzvw}{wX&=<99==;;<=>>?DFDCDHMS]l}zvxh5=:768:;=><<=>?BCAACFIILSav扁vrv{rC?==<;::9967;>??@ADDEIOV`|ȑ~uoot}uKBABA=;97634;>?==@CGGHUjv\Si|wlkkZ>FECA=;9::67=??<;@A==>@AABIWpz\LZjz}me_[O?BAA@>;8:;99<<:;<=<:=ABA=?K^x~qea^\er|zcSHFJW?C><<==;854579<=;;Kd7;=?ADFA;7568;;:;=>><=DD?:8AJPUZ_cgjjgc`dty]?2.1Jr139?DHIE@<989;::<==:89=CB<;?>:@CEEB=989;>=:76;><;:>@BDIR\fmngddglqx~pQ/!Cn1*%&.5;@BA@>;8:<879::9;<=>?AAB>?EIMYdklifccit}yZ6#+X61(%).5;?>?A<7:;6459<=;88:;=>@CCABA==??KV_flmlhgjov~{\9-;n96-((+.5:<>A=89:6447;:878:<>ACDCAA?>=:9AIP[ipsplhjou{tV66M64/,-+(,2;?==868878;>?@AFGC@>?@@?=<<>BEMYbktyyxwwpaC+:]64201.)(,7=<>A;79;;:978=?@ACHGA>=>@@?>>@??@FNWaoy~{sdN3!?j8643430*(08>AB@=;;==<:9<==@CFD?==>?>>AC@?BFJPW`kvw^?%Es9455433.**/9=>@@><<==;99:=BEDA<;==;?AC@?BFILOW`jvtY5K}{:4674332/&&157;<=;968=DGB=::<<;8:>AA>=AFJIIPW]fpxymT0Qi=9::6532/)%&+29>==<;:;=AB<99:;:9:<>><;;=AFHJNRSYcikhT3V\BA?=:752/-( #,5;;<>=;<==<==97:;;::=>><::;=AFJMNKOV\`bT7$$ZUJID?><9523/% "/:;<==<:;<;;>><=>??=<;<<>AEKLGGMSX[Q8((\YKLEAA>;6364,%")049=??@@>==>==>>=?@@>==<>@DKLGFILPVP>.-_`HHEBB?;53663/+" )2;@ACC@ACCB?<;<>@A@@A@?=<;=?CGKMJIIFGRRF74bjEFEEFEA;677652'!#*5<@@?BFFD>:9;=@A?@DC@??@ABABIMKHFDEMOIAAdvBDDFHJJC<8776/("$-5<;;>BGHE>9:;=@A>@FEAACEEC?=GMJFCDFIKJIMc|BBCGLPKC<76552-&#%-59;>CIJHB?BA?ABAABBCDFGEA??GKGFFHIGEDEIXi}AACFLQNHA;65541-(#'-38>CEDDEHJJG@<;8785/*&&)/49@FDB@BEJLJGDCBA@=>ACCB@FORQJHKGBCGOV]=;>@??@CFHHGB=:887420*&&*2;B?=>AEHKMMHGGC@=?CEE@>@HQPLIJLG@DIKLN>=@A?>?ADGJNJD?;876761+&%(3=>>=?BGKNNJKKGDBCEEC@@DJOMJJID@HMIIM>?AB?>?ADGLRPKE@:879:83*%#,6;==?DILLKMOKHGGHEBCEJKJIILKEBCKOIJP<>AA>=>BEGKPQOMHA=;<=:72-)')/5;>??AFJMPQMJIJJEBHNRLBDHNLCDHIIJMO9<>?<<>ADEHLNOOLFA<<=;973/($'-49<<=BGLOPOMKKFCKQRJ?BHLJDFKGFJLK778:;<=?@@BFHIKKHB;:;::863/+&&*07:@?@BBAGKID><<;:9753/+('*059;?DGIJJIIJIHKKGEDFGBCHIGGHJHD358978<:865432/)(*.37><9@DJNOOKD?;878876641,)*.4BB8+#$3CVſaA+!#.9A@?<0"  #1D]ѿpP5&%-9AEB=5)  "/CcӸz[@,'19@AAC<,#   #,@dcG2),;AB?<>6%  $,?diJ5(*3BE?:55- $,?e~eL7,+3wûļrQ:/,/;D>4'   !&AŽyZ@0*-7AE9,      'KĸdG5+)1@FC4'    .YĹQ:.)+7GF=/$    C?8.#   1c(6@C=4(    $J¿#4>?6-$!""!!#! ! Lz"6<:0(""##!!#$$#"" +d¼½#9;5+%" !#$$#  3nŽ)74-%""!" !""$ =z¿05.&! " "%$! ! "$# "GȻþ76.&"!#%%""!"!  'Rȼ»:5.&#  "#$%$#"!!  /`Ž71+'##%" !##$%$!! !  =r¾6/*'$$%" !""#"! $U½5/*&$##! #$" !!   ?uý¿2-'#"##"!"! !" 5f/-% !#$%%&$   )T10'!!$(()&  4\¿20(""$))((%     C|¿0.'""%)'$#" !"##  C-3+%%'*% !!"$$  $OĽĿ+;3+*++%! ## 7eǼŽ/B>8630' !  ,]ŽĹ2EJG?81)!  #D.EVWC6.'" /]þ¿':PUB5,&!   Bvƿſ(;D<3+$ "" (\»1=:2(!!!""#"91(%$&'&#  8p}vsqpmifa\4",:A7.&$%%$#! $Bz}vqpplhc^Z)"5?A6,&$$!  0T}uommie`\Y ,>C@4+&#" !Fl~wrmifb]\]$4DD=1)$! ,Zxsmfc`]^a)9GD:/&   6f|sojea_abc0>HB7-$   'Iu{spkea^`bd$9DG?4+#"!  ;fzvuoga][]c,?FB7+$!   %Pysqlfa^[]d'6DE<.!  6dxpkgda^]_d1@FA6+"!! !! %Fqxqmga^]^`c&;FC;0)#"$#! !!"#"8\wqmg`^^_`b.BH;2,&!"%&#  !#$%"  :Y|vnifddc`_`3DG6,($!  $''$! "$%%" %Jlwnhffeb`a%6AA3*%$#"!%''$!"#$$#  'Qs{ojggfdccd.>A<1*''$"  "#&''&%%$#" -Z}~tmjiihdej7E?70+))&$##"%&%')'%$"  4dyrnlmlego@E;2/+)''&%%&&%$#"$&%$"! 9p{vqopohioCB7/-+(''&&'&#!!"##""  "Cz}xtqpokkoA<5/,)'(*(''%#$$#!!"#! +Q}wtrnlmop?93.,(%&(()'$$%##" !"#  92-+'##$')+*'&&#$&# !" ,Syzuojijnon;71,)'$$(*+)&$#!"%# "#! (Jm웙zslhikll85/*'&&%%(**'$" !$#!$$>gxpjfjljjk40,)'&''&%%&%" "$$#&B_{yqmhcgjggl3/*'&&((&$""! #$$!1[vulkgdilijo63+%%&)'%$" ##"#"2dܚtmkiinqppr36*#%(*(%$!!""!"!7mxsppqttsst0:,#(*+)&#! #%"!! $Dt~zwvxxwtsu0<2+-..+'#!!"## !Ab{z|}|zwtwywwv/<:731/,(# !!"$$1\|zy{}~{vptww(8EF80,*(#  "##%Cl}wppqprw"0AF7/+)&# !""3Vw}wpmkimt#3:3/,($##"!!" Dj}☎~z{{zvpjfdgm+640+%"#$&&$#$%%!,V}{yyxtngcbek"(340(#!$&'(('(($#' Fs}slljiouuvx{~}vtvws{xrcM1,=Zx|rlkiipw{{z}~yvvypo}~pMEXk{|{~{sommt{|~}ywvwst{~|~f]ds}xy|wttuw|~~{vsr}vvyz{|zspz{{|wuwz}~~}|zvss{ux|z{}|{{~}|sqw{}}{yx{{z{{yxxMLKJJH?3%*8GWqzyyrZ< $R[Mb]RNOTWVQJ@::855e31/MNNMMKG<.*:CRh|{|{qY< #QXJ_^XVUVURNIA;988751/.NOONNKE6'!4DJ_|{|~xlV<  !NYJ]]XWVTSPMHC>977531/-OPOONI@0!.>MTl{|~xkX@"  L]N_^XVTRQQMID>8665430,SQPNKC6'-?JTcz~{||qaJ, JcTdbZRNNPTQKA95568983+UROJE9+-?OXbu~~ugQ3 HgXec[QLOQQPK@9889:972+URKC9,'BS^huvjV8#D|iYcb]RNTRLKIA==952/,RLA5**A\mwyiV>,>tiZcc_SNUUPMIC?><941220LB4&&C^tygUE6)8kh[bc_RMUVSNIC?=94/.343A5& 6Yt}tdVKA7'3di[`^YPNTURKD=9874201226(4Srł|tk`WSNG7&.Z|g\a^XPMSSOHA:6655420//+%R|ynf_XX]]XJ8!'Jiud_dc]PKQPKGB<876542/--" :l~xpg_ZX\gjfXC'"=Uc^`fd]QLSSMIE>977520.- )T섇~xnhd_\^equp`H*2DQX_fc[QOWXRNH?9679621/.  o~zvrplhdfmu|whS>*+AUbe`_]VSXWSNH>7643211 $V|zwrnllkkpys_L9(0FW`ca_\VTXXTNF<77531011 3lyvwvsppsvv|oYG7) (;;951/./2%N}yvuy{{z{~xfQ?2)%&5KZ_VWa`[UTZZVMC<988630./1 =n~ytuy}n[G8-)*/BYbc[[ab`WSXYWOD:445641//1(V~}xtxٍydP=3-(*5GY]]\]`a`WSWWTKA:54321011o~}yv}oXE5/-*0=N[XW]aba^WTXVRI@;7520/0122:M}||wcK9/,.3=KZd[U`fhbZVW\ZTLC<743233112Lj~~nYA4-+/:FQ_h^X`gjbXUV[ZSMF<644554213d؊yfQ=2/-1?KR]ga]`dh`WSSXWPMG<55796445yvbO>3.-2CPX]`abaceZOOT[[UOH=767975567r^L?3,,4FU^^Z_cbccTGNV__ZQG>98876679͉|iSB90**4L[__\]_`aaUJRZ^^ZNC=;::97546:vaK;5.(+7Q^_ab^[^_]UOV\\[XL@=;;::7546;mYG;5,%-=T__eja[][VTTXZWVUKA=:9897657;ucQC82+(2BXa]cib\\[XVVYXTQOHA<987766778zkYI>6.,/8FZb[^cb_\[]ZVXWRMIFB<98755874s`OB:4.08DP[`a_]bd^[ZYWXVQMIGD?<:85575Ε{jVG;6427ANXZ_e`Zae_ZUVXXVRNKHFA><96556sbO@547=BIS[\]``_``^XQSWXWUQMKG@<<9665238~jYI<328DJNU[[\`c^ZZVQTYYWVQLKH>9:7566349|s{waPD:428EMQTVXYY`f^WUTTY^ZVSNIHF<65437:77:dVYf{p[J>7427EMSX[]]Y]c`ZTSW[]ZVRMHGE?:9658:989M;5Be}ՋyiXG83239DLT[adb\[\`_USZ[ZZWQKFEEB@>;88998C5,3OlrbQB5/0;EJMQY`ba_ZUZ[TTYZZVME@@AA?<:89::98>4.1?]zkZJ=3/3DOQQV[Z\`[TVWTUYZZXSJB=?A@>;989:99>27<;V|tcRC815?LUXZZVRNQZ][ZXVWZZWPLKGBEGD@=:8867;>*4:5O|~yo]L>52;GNTWZ\WRNPW]`]ZYZ\[VLGJIEGHD@=:88757<@!%,-KyxkYI<65?JLMPTXYZYXX[`^]]^]\WLEGGFEA=;:97557;H!$-MyzlWF<66CPOMLNQVZ^]Z\^]]__][VLEDEGGD>;::963357W.$(8V|}mUD=99GTQNLKMRX^`_]\[[^_\XSLFABFFD=9::=52334s[ML[m~jSC>=BIOMNTTPPRY_db^WUZ[YUPJEBBFEB=99:<74455|qoz{dOB>BJKIGLXZUSRV]ee_UQWXVSNGB@ADDA=:8:<96778zs\I>>EPLEBERX[\\XYacaWQVWTRNE><=ABB?<99:989::kyyfRB<=?AA>;:9:99:;:Wdt|iWG<;GLLNPRROLLW`][ZXTRS[WLMPHB@?>??<::9;:8QWcqu\K@<>GJIKNTWWSPTYZ\^ZSNP[ZNOPIDB?==9889976997NMT`n~oPA:>;98:;85459EBMUSXcq~x]<02=EBHRQNKLSY]^\SQVWX]bfbYOF@=?>=<<;9;<:868977;<:;=<FHKKHIKKOZfqztZA-2@GJFEFKPSV[WPUYXUOOT^ed_VJ?:8;:668:;;=??@BA>GJKKHIIB?HQXclmcI7.6DILKIFFINV`\QOOTUTUW]aa[RG>:76559<::<>@@?>>OSLHKIB>A?@DGHPWTSSUWWUOOUWWXWTPIC>;99:;?CDB==??><@BADHKH:6AEFB?>@CA><;@CFF@=?ACA><;;OIEBD@99;??>@CIIDDFFHGEIOVYXRLQURQT[dfd]WTKA;:=@BCB<;?@?>==̽ȍƍķǻ ʾµ÷񷳭ܳĹƼ좤ͲƽüŻǻѯľûζƳ򳵷þ²ľŴʲÿľĽ½¿轺ۤ¿㬷𹲮󶳯ľø¶ԧͿıÿ²½Ľû񺻾˵ľ¾ƿ뺹̷ƿĿ¾񼽾βƿɳļǾ¾ͽª¿Į»\_elpy~|~}|}ytsvwtssyY[bks}~{{|}}~}zyyuvwvuuy[^bjsz}|~}~~xt|~~~{yywtv{\`dksx|~~~wsz~}}~{z{xuuw~\`hopu}掍{wvy|}~~{{|{yvvz^ahmowzxy{}􄉆}xz|}}ywvzabeipz~}~|{}{|xz}~|wqs{aafkqx}z{~}}~|~|}yplnua`horv|~y{~|{|~}sjilsabhnrx}}}|}~|wpllosxadkpsx}~~z}}xrllotx|_fnttw|}~}{~~}~xzztxyvtsstx{}\ckqtwz~}}~}|yy}zvyywusrsy}Z^eltxz|yy}}~}|}|zupoqx\]gouy}x{~}}xsrsuy_`ktx{w|;~z~|wvvst{dgpx}~{}|y{{yvrsxgjpv{}zz|~~{yy}~yvutuxgjkmrvzuu{}zy}yqpsx{{hjjkorux}|{}{z|yqps{}{hklmnopqvĂ}z{~}~|ust{}yinnmlnrv|}{zz|}~}ztrvwthnmlknuz~}yyz}}~~wqqpdhhilpuz}~~|{{zromlcffhmrv|~||̀~wpmmeghjnsw~~vqqjihinru|Ƀ}{}xtsnkhimprx}Ӏ{x{~zvsomjjmpqv{}򈆃~||}}~}{wqnljknqsw{}~{zz{||}{~~}{wpmiilptwz|}~}zxwwy~{zvtmklotx{||҃}{xwxz|~}yunoqtx{}|zy|ywvy~|xzz{|umotwvwzzxv||xw{}y|}}~vmpvyttwwvty|y|}~xptwwuuvutrw}{~̄}ysvutvwwvusz~}~y䈆}|uwrpvyzyxy{t{}uvppy|{wtuz~|x~}z{tspr}{smlqz~|wtropsxyxrlkox~~{vrmprsttqmlqz~yurqqssrporw~~}}xusrrsw|茊@~{~~zz~zprttpqtux|~{tu{~orvwux}~~}}wvznpvz{{~}{{lntyz~~}llsxy|̍nlrwxz~ԏppsvwz}ߒsuuvx{~uzxx{~w}{z~悃򊍐Ҏw}{yz|쎏~vyyxz~svxy|~~~srvz{~zzutw{~䀃􅃈~z{utw{uux|~|~{y|vz|~~}{z{z}}z||zz|~x~~}{yz}z~|~}y{~|}|zz~~|{~01466:BLXfgXLCAA>>@ACEIPTUSNGEHGDBACC>@CDEEFILNNLF?;8:<<=@ENZ/1478=FNXefXMDB@<;BFGDCDGJKLMIB;8=>ADLX.0358<=AEJMQTPIFEEGHFDFD>=?CEB@AEIIJLIC?>@AA?<;<>FS,.147;?KXfjbUFDDEC??BHLLORNHIIGHIIHE?=>BDA@AEJHHJHCBABBA>;:99@M)+/47:>FQaifXGCEHHDDGKMLMPNMMLJHKMJD<;>BDBAAHNIFHGCA@AA>==<969D)+/36:?FO_ij]JCBEFEGJLNNOOMLMJHJLIC<;>ACCBBHNJGHGDA>??==?=:67>,./25:AHQ_imbOC==@BGKMORROOJHJIHGFGD===>@=;88;//366:?DKXciaQC9:<@EHKMPNJKNMMLKJHHE??A??DEBFJKKJJGC@??@A<77:1/6:8;?AER]e`SD99;?BEHJKHEGKOQONNMLKGBBC?>DFCFJLLIJLJGDBAA@9457;/.5;=AEGJQZdbXH<:;?ACEGGECDFMOJJNNLIEDDA@GIGGIJKKJIFEDB@=;877;A./5:>BGJNRZfe\MBAABBCFGEDCBDKMHILKJIHEEGDCGIGFEFGHGEA@BB><99:=C.169:=BHOU]hh`RILMIFEJLGDBCFILLKID@DDBFKGDFECA@AB??A=:@B><<;;<>B/1478:>FOYahhcVMQQLGCILIGGHIHILKHDACDCFHFDDCBA@@:89:=?@/0258:;DO\degf[QPOKE@FKLMNNMGEIJHGGEDFDBBCCDCBB@<=@??AA>8259<>?--16;=>CLYaaeh`UMHFDCJOOPQMHGFFGHGFEEGB=AEFFB?@A@BFECDC@;6788:<-+28=?@CIT\_ekdYKDCCFMRRSKDGGDEHGEED@;AFGGFA=?ACGLJFGFC?;:967;..5;>??AFPZaineZRKECFLRUUSLFFDFHHC?=<>ACBBCB@?@DKQLGJJEB><:9:<116:>@@?BKU`hmf]XQGEGJNQRPLGEEFFHKKE?9;@BCBBCC?FLQLFIIFC?=;<=?3557=@A?>ENZchgb]UJHIHGIIJJHDDILLNNKD;?HLKHEEB><<=ACB236788:>HQYckmjc\VVWTPMJFILNLFGMOOLJJGC@?>?CA>;<=BC@46779>A@>@CBBABC?=?>;586557:=BKRU]gnpjbXUTQNNLHHIKKGFGIICADEFGGEB??@AA@>@BBABDFA<=;75620257;?ELT]elmf_ZSMKJJIHGJIEEHHFCBBCCEFDA>?BDEDCAA?ACD?;;:75620257;@EKS\elme_[TMKKIJIEGKIFEDBCEEDB?@CCDDBABA?=:86643469?EIMQZemohb\VQPQOMJKMMKGIMKHGFCEIGEDCBBCAACDBBECBBEE@<:65446:>ADFJQW]gmkf_WQOOPPNNLJGHKNOKGBDIIHGFDCCAADDCCBA@?@CEFB>;75568<@ABBFPSVakmiaXQNMPRRPMKIGGOTOHABGJKIGECBCCDDEEC=;;?CEEB?;96679:;=CMSXbjjfaYRPONOQNJKKIFDJONJBABBCDDCA@DEACGFDBA??@CEC?:955468;ALT\ejgd`ZTRQOOQMIJJIFCFKMKDAA??@@>DEACHHGGEB@?CEB?;7224668:;ANXailgb^ZVSQSTSOKIGGFEGKNLECDC@><;;?5236::9;=@CEDGJLJFC@@A?==347:>?=>?=BP\fmpomibYRORSPIDCHQROTXUOHC@>==?ADFFIMKG@=>>=?@?<84579;=>??;@NYcjnomhc]WSSROKIKTRMQTQMHEC?=>AFHHFFGIKKHA=?@@BCA>:65788;>?>:=KV_fknlgc`[VUTTRMMSPHLPNKHGGCA@BGHHFEGHHJJDBCCDEEB?<879:9;>>;799:;==;9=IRZbgiic\XUVVTQNKIKIFLRQPOMLMLHDACGGFDBFKMLJIHGEB@?:988:;:<>>AHOX`ehhaYSRVXXURQQNKPTRPOLJLNKIEEDFC>AGJKJGDFGDBB988:=<8:==?CKU]dhjicZSPSVVROQRQOMMOOMKJMONKHFEDCDA=?DHJJHFIICAB769<@=78::;?GRZbknke^TNPQQNKNPNMLIGKMJJMOPMJGFFDA?>@BEHKJILKC@B548<>>;868;?FOYclolg`VPOPPMKMNJJKGDKNLKLNPPNLIFFEDA>@CFILKHKLHED658;==847<@FNXclpoiaWPOOPMKNMGHKFDLONLKMNNLJGFFGD@ACFIKIGKMKHD;:;;==;758=CIPX`lrsmbVNNOPNLSRFFKGEJNQLFGIJKKJHFEFFECBEFEEHMNID?==;:;;:769?FKPV_krslaVONOOLKRRIHKIIKOSOGEFIKKJIGFFECBDD@@CHJFB?<<9889;98BHKNS\hooi`ZTMLNIEHMRRORTNNRRPHDILKHEGIHE@BDEB><?FIKS\dkpmgd^QKMMLGHPQNPQKILOPJEFJNLGCCEFHIIGCAAFJIGC657:=?BCB=?FHHR\biomgfbVONONHGLLIJKIILMMIGHKPOKEACGKKIJIECCEGHGC7469:>CCBABGHGMV_gljc`\YVTOJGEEDEHLOLFEGJNRQMIGGHJGEIIFEDCDFFC87887;AABEHJLQXahkic\WVVPJIGBABBCGJKIEEFIMQNJGGILMIEIKIHGEEGGE:<;958??>BFJNSY_fjkje[SQRUQMMJA@BBCFEBEIHGGIMIDBEKPRMIKMNLJJHG:><98;@@CGJNSY_dhllh`ZVVWSNKHECBDFFEBGNMKHGIIGCDKNNLKLMNMMOOJGH;?<:<>ABBDFJNRX]bgmnkfa\YXTNHFKHDGJHGFLRRNHFGIKEDJKIIKMMLMOQQIFH<=<;<>ABCCEIMQY`dhnpoic^YSPMDEPOIJMMNPSQMFDGIKECFGGHIMNKKLLKFFI<;<<>ABBDIMQZadhnqqkd^XQOMEEOPLKMOQQPLGEFHIECDFIJKNNIGHGFFHK<:;<=@DA?@ELORY`bgmqqld\WSQOKHIJKIIPQMMNNLJHFGHFDEINPPOLGCBCFKNN;9;<<@DDA?CLPRX\`dknng`YTPLJKJEEHHIPRONOLJLKHHIHGEHNQPLHECACGNRQ:9;<;?EFE?@INRUX]bhkjbZUPKECIJDCEGKPRQQOJGLMLKJLKFGMONHEFEDEIPSR<;=?ACECB@BEILORY`gmne\UQOJFJLJIIJJLMMJFDEILMLKJKMMNOOLJJLMNOM>=?AFFD@?BCBDIKPW_fnrj`WTTOJLMONLIHGGC>@DHKMMKLQQNNOQPMMPPONLK=??@DDA>>BC?DLOSY_emrme]XVPLKLOLFCA@ADB?@DJMMPSQONMKLMPPMKKMOPRS=??BCA@@DD?DNSVY]dlroi^XTOLKLNKECA@@ABBCEIKKQVTQMKIJLOPNKIKNPSV>??ABCEFFEBFOTWVYbkrrk[RPMJLMKKJJHEA>BHHGFFHNTUSOKHIKMOQNKLNMOU¾M*!('&a4$"&{E""#$$!¾X&!'#$n5$!("$䷿ĿŹE) '+M#ûW0 %/;#¿n?$ !.4bb䩲P.! +0#㭵¿_8% $*="߱qG+ $6D⳷»[3  26!⵸ļl;$ -1!භſ|C*"  (-@KݴL/$ $*58*౲X6'" )45ମjC+%"+74૭þ¬|Q0)& )69C۬ƶ`7-)$%2;TTCC੨źo@1*&-9E>ܪ¼L7-(" '7ABF٤_C3/( "5@FRFF⫲qM63,! 2>GM9أ½T4/+$ +;HKC59ۥľ\5/+' %8FIHFۨžh<3-) "4BGIG֦ľyO<2-$ /=CFFD<I٣þdG71) )8@EGIIۥvL62,$ "3@GIJJޢR72.(/>HIID؟[;4/* *;FIIGE٤úc@61-! $6CDEFG۫kF82/' 0>>@FG7ҩþwO711*/;>@DGCϨþhC-./,%6>;%ԦžvK,.20$"3;:;=@CEI<०°R+064(.9::CJNPP9@ 贲uH,''+*)$*<@=;;=CJMMI@B ֩¯W1$ $)+$);@=97;BJKID?@GW ȷ¿_4#!(+!$7=<86BDDEC;774??ͮýj:$#() "1:51#򶷷ۯ°tC&#%&#&0:A9239BGIHFB<2/12ӰñzJ*!$'')/:D;339DIKJHG?2045EȾ}O-#)*+-:H@75:EIKJIKB4244ź{L* &*,/;HA97;DHHFGLG:4001hùzI&#(,/;GA:8;BEECDKJA6./2-*ƻîzH#!&),8EB=78?BBACIJG9.022O**ƼİO%!%(*6CA;67>@A@BGKK?3//01eѺƵ\+#%')4A=757=AB@AEKPH.% ,4c"߁hI2'#&1Oh₈wY9+'#-FL!⅊d?/)'")>C!nF3,)#$7=S_݅|P:/*%08HKUZA2+&  +8IK||}eH3*$'Twkkzyz|lL<2) $5Piexy{~uUD7,$ -L^hztuwy{~aL;.&  'EVjzzpruwx}mT@3*$ !?Skyqnpsvw{w]G<3):Tktqoqtww{cJ@7, 3Ngr}suwyy{jLA7.#*E`o{|tvxyxz}~tXE82'#81(0J_nv||nosvxx}|VA<6.+CYktyxwrtvy|[E@;3!&>Wjqtuutvyz{|}aI@<8( 9Sgmort1tvwz~|vuwxhM><;.4Nchlqsqw|{z{wqpswnQ=;<3%-H_fkqsrnz|xuqnptyuW<9=8+'BZdkoqrtzxtonqv|~_95<=3#9P`hhlrw{zwtopt{h<5;?8!1H\fejrvU~}|zvvx|qC8:@;%(@Xddjqtx{U{zyyz}yM;8><-!9Tceimqvtuwvvxyz|}}~W?5;=6$2Pcfhhmsrvtstvwyyxy}^C49=:',L`efdhkqPwvsrrsuvvuwz}fH49><,(H]ddacgqlvussuvuuvww{qO5:@@2%D[fe_chrzvwtssxxvtsvxvz{U6;CE9&"?Wdd_bhpuvytqryzxusxzx{[5;DH@0!:Qad`bgmpu~|ysquwxvvzzwza58@EB8%5Mad`aemrx~U ~upruxx{wyh86;?A>*1Iaf`_clsy{̀vquyzxw|~||~o@9:;AE2$0Fbf^`cgmtvpc ~vsy}}yv{~~}|}vL?:7>G8+0Cae\_bbhrtqpj ΀}vu||vxz}}{ww}|YF:27A8/1A^b[[^agqsrsj ̓{y~|wvw{|{yy}iN:018630=[a\[\ahprrtxufʃ~}{yuuy{}~xU:/,.46.9Wa`\[biprqtvr0affȉ}xwwuv}X:.)+48+3Sac]Y`hprqtune{􋉃}wvwvz܃Y:-)*49)/N_e^X]eoqqttmhfƄ}~}|{|[:.(*4:-0FYe`Z\clopssnjcTxx̀yvz{x}_<.'(2913BUfb]]bkllqsoka[W|wwy~fA.%%-547AThfa`dkifnssk^\chŋ|wvziE/$#*358@She``djgcjqum]XXVxȐ|y|iG0$")159?Rgb\]bifbgnvn\VTQÒ}fC,! &/6:><=??EYhonhge\TQ`yw`NW;@AA@AEO\imie`_YNO]}kPNl:<>@@?>=;AIMUciieab_WSXszYLYyƤ=;;>@=;<<;<>>DR_kqsnh_WQUdvBBj=:889<@DBFS_iopkfaYROZvME`x>;:879>CGEGQ[eknjea[UOUo\LYӽ?<;;:<@EGFGMU_glkg`]ZTXllWUz@>==>@CEEFJPW_fjh`[YTWhzdStA@??@?>@BBDGJNV_hh`YURVevrToB@??>=;=?@ACDFNXdhd]WQSarZjҾhA@@?=;:;=>?@ABJT_fgbZQR_ocḭ?A@@?=:>@EKS[cif]SR_lxqj{@A@@?<>??>AGLQXaki`TQ\foqvΜCB@?A@??A?BHKOWamkbVPV^gy{tC@??>?CDBDHLPU_lkcXRSZewu CDA?>=<=@EGDDGKOR\jjc\VSYfuxCA?A@>>@FHDCDEHLWgkh`YW[dqϻ CB@?CC@?@DEBB@FP`ikd\YZal{ BA>?DEDA>>?AA=@A?>BHP\hidYVZfv˿HIEBA?=>><;>@ABDGJNZfhf]Y[fv%HIIHEA<<><=BB@CEGJMT]bc^ZXbsȽHKLJD==@>@FD@ADFHJNS[``[U^pŶHGJKGDBCEBCHFA??CDCGNW`d_T^qHFIKGGHHEDGFB>=@A?BIU`idX`pþIEHKLMOLHFDD@==>?BGSamlbdm~KFIMOPOLHFEDDCCB>=?BGSaoqiegtNILOPNJIHGGECBFHB>?CJS_oslc_lxÿNOMKGFHIJJHFDDFGB@AELS]kojdblx}¼PTNGAAGJLLKHFGGFCBCFLR[gkiedmyyŻWYOFCDIJKMNMKIJIEDEFIQZcikfaivu|ȻYYOHGHJIILNNMLGFIINU^flf`fsrz̾WWPKMLIHHKMMOSQNIIMMKILXbjf`coqyĹÙW&ҍ)&L %|0$j$)#P#ې<#c#"4 !p"!ݝ9!T s#H Ѕ0T@vA|1k?}' O !1!p!6"b##M#~%!%O%D%k&4 &i'+'P (}1(_(َ%(F*y-*S*߇&+c",J ,< -֓/ .f$ /X /9 1w21n2Y313h4R4ԍ(4\6Uëǿ񩫮Ƹ¶ǻȱ½}ʸwyݰyu¾ɻ~rwþ¯÷no~ſrmz}ԼswW^򱲯諑|t5Txkgx)(&$"#%(*))+4Vy}gm**($$%%&')+))9Sx~jf'((&$#$%'&&-:Ql|xi{$$%&''$"!!#%'(+/Df~sp""#$%&&$""##""%')1Bd|{k|!!"$$#"$%$" #%'(,De}typz!!"#$$"!"%()'#""$&*1?^uq%$$#!!$&'&#! !$'',?\zl(('%!!! "%%'+:Wvks%%'&"  "$$%&+7Opgdt !%&#! ""#%&&$0JyiZd!##$$"  "" "(+((.Nru[[!"$&$"!!"!""!(+($"2LqdYq  !$%%$#"  !$%##%)3Imr`h !  "%&%"  !""!"%%(1Isjaw¿ "!#&'$! !"!"$%&#,Bjw_mľ##" ! ""## #$"!!%'#$.Fhdh&&$""#% !$& #%$" $'%$%,>klfx((#!"$%$#! !#%" #%# "%'&$'Afugk'&#"$$%$#"#$#"" !$# %()$!)Cwne"#%&&$!"$%%" !!  !!#(,+(#-Qwzd{ !$&%#!!"$%&$##"!  !%*++#$4Vkw $%##"!!#%%# $&#! !&)+&#"9dvv"%%#$%%$"! #%$#! "%%$! #&(&# (=lx{!$'&$%&%# !"#$$#!$'(&# !#%&%! $N{t  "'&#$$#!!"#""$%%')&" "%%$" !#%&$! 9`q !%%"! !"!!"#$(+)&" !!  !"%&$!(@qp  #$"!!#%'(('#""$%"!!$Eoty !%&%!  "$%%&%"!!"$%"!!*P| "&('$!"##"!! !$&&$" !!#%#"!7z"$%&&%""%$ !""&)&$$" !""!&S}y""#$%$!!%$ !#"! %*(&&#!"3\u!"!  !"#"!#%'('&#! ! #%%" !!$" =qw~!!""  !##"!#&'(('&%$#"!"#%%#!  !$%"'Ky}w##""!"##"$#"#$%%&'((&'(('&$"!! !"#&$&Yq~'&" "#%&$#$$##%&)*''))('&&')&$##""#%$ Cpp|y)(# !"#%'%$$##""#%)*'&())()*-0-*)'$""#$$2U}r{w''%$&$"$%%#""##""#$##&'%%&*,**-1420/-($!"## #8lyw&&'((&#"##"#$%$$#"$%$$&)+))-02320-'# !""!!)Yx{}w%&)*('%"!""#%(('&%$"!"##%&''&'+,,/0,'"  "!"$!(Gcvvoxx|{xx|m^VVXW]hnsz}z}zsuussvy|{z{||~{~vfZVUTXaktz|y}{ssrsuw|}{xx{~zi[SRU[fqvz|y}ttutpmlpv}~zvt{}|ߊzgXTTX_hov}}xx{zqkjpx~~yy}~~{yy}zg[VUVYer|zz}{rmlrx||x{}yvvy}xeXQMN^n{~~zzxtssuvxyy|~|wuvvw{q\MEGXix|wuxwwuvz{{wtuwz}~xtxzyyxy{kTGEO^ovwy}ttsvystwz}|plx~}|{yyz|aOEGSerx~ww{{xwy{zzxmit{}}{yyzws{tXBAMdrw~qr~zvx{}}yxwpmuz|}}{zzuou}fGAJ`ms{_bvytrx~~|wx{{zz~~{xsmouzwUGFUaktzz~LPftuu:z~|zxz}~~|zz~}zvrnnpsyhPDKVdpwuy`sy|}~kS[jw$%(,/0/.-,+*+-23.**+,,-1>O`p}|romjhdXI66Rhx|}~pYYbr}%%'*,.0/.,*(+/21.++,-,,.-,/8Mdy|vusnif_U>6H_v|{|~saY\nz0/)%%).11.+),10/--/.-,-//.-0:Nly}}zqljhbK>BWu{y|}}vi[Xkw|32-)'(*-//.,,-,*)*..,,-/3@Thx}{tppngSD=Noxz}~~{t`Wky331-*')-/00,('&$&++*-026;PjuxuuvqgYJ:Fdt|~~fXl|552120..-+,00.*&##%'*,,(&'*-/02>Petwyzsi^P=AWjy}k]jx66203431.**021,(&$"%),,'&&(*-..2:PetzyskeYC>J`u}qcep44200//./011-**+,*''(**+**./.-/7HguspnndJ>@Zu}xh\cz3310-,,-.231-))*,+))(*,-+),..,++6TgorqriSB:Spz~~{mX[v~330.,,-/021/+((*+*'%(+-*'(*--,0bvoidRGVguunppg_[j../0011-*/10120//135542-++,,*'(**-+&%,KdmokWGQ_nqlpqjaXf},,.11.)&)+./.-.00259952/.,*))*--)" 0Jlxr\ILWgkkruocT`v00//11/+()++*))+-./15764321,)('&&(,,("!5bvtdSNS`giqupeU^py}442110.-.-+)('&')+,-/23443.*)&$%'))%" &Qiqk^QO[ciorpgW]lty|00//11024640//.+('**+,./00//,''&" !7RmqhQJYckmmngZ^jsz~../110357512430+*++)((*+,-/01/*)('%" #;_onSHTalmloi\]fr|11//110//1443100/-)()+,-..,*)'$#" )JcnXKN[mppsm][ap}11/.//0/13433221122//.--.-,**(&%$ 1Pf\PGTkqsun`WWerx|00.-,-/13321121122113688740..10-,+*)('%!9X]UBMgqutnbTLWepvy00/.-.11310/0024689864477520,*(%#"!*G[ZBKdnrrmbTIWfpuw0011/031/12100//01235799;85/+)&#$%#!6T[FL`joplbSIZkqux22442231./00/12112101236899:951/,)(&$ &GVMP[dknkbSJ]oqv|4412320//0/.0100110/.//25677;<830/.,)'$! ;MOPQ]hlkdVK\lot{5530.044321/.--,-/.,,.-/13466=?81,-0/-*&#!$3ALJDTchjj[LWcjqx<=@DDA<;?DIFBBFLJGIKNPRTTRK>610/,.49=@DIMQPQX]_XMDBILHC>@A@=7<<::=?ABB@>>AD@>@CGFEKOQSUROROF<30-((-5:=AB@<99:;;::=?A@=;;>ABCDGKOQQPNLNNJC92,((+29=?CGKMQX_d`XOIIHE?:<@CCB89<=:879=A@=:9?DCBAFMPQPNLJJLIC90+)*.48<@DHLRX^dc^VOMJGA<=AEGF=>AA=:8:=@@=?CCBA@DIMOMLLIGFGJNPF:1+))+18BFFJNRW\`a\VUQKE@BEHJI?@BB><:;=?@>AEDB@??ADGIJLMKHFGJPTND7-'$%-7BEBDHNRUZ`^[YUMGCEHJIH??AA>==>?@AA@>=??>?AGLONKIHJNQRM>0% "+6AC=>AKPNS[^^[UMHFGIIGD>>?@@><;<=?@@><=??><>BFIKLKKLRSH9(! &/:>>?BJOORV[^]WNIGHJIFB>>?@CB?;9;=>@@:8=@@?=;:<=<=>86:?DDB>=?>=AFGILKIKORM@-,6;<=:8:>CDC?=?=:>BBEJKJHIPQL7)3:@DDFKPU^ca]YUPLIIHGifWI?;;=@@>;<>A>=><9;>=?EGGKPS@()28>A?AGJNXab`\VOIFJIE~fQC<<>AA@=>@AA@><=>=<=<9::9;CGIIJIMSG4&$+4;?<=CGLW`cb^YRIEJKIx`OE@@AA@?>>=<;:<<;9869AGKNMIJOLC/!#.8>::@ELW`cc`\WLGJMN|hXJC?=>BB@=<=>><:89;>@>;55;;BGKT\]]\[WPKKLLnZKA<=BB?;:=>=:767:>AA=538<@DHIJLRUG3%2<;=DHJQWYZZYWTROMJp\LB>@?<::==;85678:<<:43::9?EILOSUQC&)5:?DGIOV[^^[YYTNr^ND?=<;;=<:74787789844986;BINQSTVL1 !/9@DFHLR\ba\XXZ]ZRw`NA==>==;:76:;767887768>JPPQRTN<))8BEGHGK[dc\SRT[\XxaKB@?><<:9<<86799765446;DJMMONH7! 2?CEEDIXab\SQRZ[Wx\MFA=<=?><=<989::7443358?:68:98764/2=GOMOZVF-)=DFILPTXZ[[ZZWPePHA;99 <@A@<9;:74221*+4COMMXYQ:$"5?CHKJNW]`_]]YT}fTF=:;<>@@?><;965342*',;LLNVZVD.0;ADFFKT\a_\\ZWePB>?AA=<<>>9669:95.($2DJOTWUI7#-7>@@CIPX_\YXYZjUJD@>;:;>?;88:;:73,$,:FMPPOI=* %/:<<>CIRZ[[YZ[n[LA;<<;=?<;::8781&'0?IJIHGB2&&59:;>DMU\^[[ޝqZJBCB?=;99<:64482$ %6CCHI=/ #17;=AHOVZ][ZYƢnZMIEA<878;954594&/=@AAHLF9%%/7=?DMRVYZZYoZLC>:8779879:=9.#*9@B@DIKC0*.8AAFOTVWXZ[\졟p\LB;87789::84(&2=@>ADIE6-,7AAFMRUVWZ]_åt_K@:7789:97557-"")7<;=@B@8/)3>@CHNSTV[_aäw\K@97::875458.! 2:;<>??=3(/9>BEKRSU[_aإr\J>:><766568.!-8<==>@6),49::975.&(4=?>==>7-+/:BEKQRTX^cәpXJGA=<<;852-"$0>A?==91,-9BEKQRSU[bnYMEA><;9885)! ,>BA@><:70.9@BIPRSRV^⡜s[ME@<:9;;8.#$9@A@??=1,7?BIOSTQT\ᡣnZMD=99<;80&/:@@CDB3*5=CHMTUPR[˟s_PD<:=;62)'5@ABDGG9/5>AEHNV~\G><=<91%%7@DA=:;8()9<;=AKSZΥpWD?A>:6, &1=CA>:<:-,9=>@EMV]¦lOFE?;;4)(-:BB@=>=219>AEINV`̧dRFC@=81+*8BDB?A?305;ADGLU`ɥx^HDC>96,(5?CB>@?5029BCEJR\ţiIDA;86-'09A@;<=:518DFGINRϢy[JA<;9/&,4>>:<>;5.6CFGGIM񢞞ӥvWBA@>2'*0:<:>@:3*2@DEDFK򥡠玑dLDA@7.*-599<>;4,3?BBEJsYG??<6,*269;<;7.4>@@BEIlI?<-&,5>=;;7/06>DEHKɩhO;;=0(*2=<:=:213;ADFIϦv\>9:3,%-;=<=:3.-5?<83+%.7>ABţqR<95+$.9?A@ʣycD-21#&3:=<:6+$0<@A?ΤuQ110))/6;><5*$2>@ABƤeH:2-**19<<8.&2=>@B̤~nN81)$,58:=4*18;=>򪫬E}»󨧬ͭ䮫å-þ½ý¿Ŀ߹ᄑӯ罸­¿¿ٺý𭪨¾¾»çĿ쪭੪ꨩϻļŻ២Ż꺷üľ½¿Ŀ㰯ÿ›żÿ𦥞»෶ÿ¾¼¾ÿÿûѿĽ¼ýĿĿĿ󻺸񹷳ҥĽ뷴ĀºÿĿþ񨧧ſ½½¾ʶ¿õ¿ﵲƮľÿ汯޻ȸtvtsttuy{zxwwxz{y}~wpllkkgc`]\VLOYgpopux{|}|{|zwtuxz{zyxwwyzy{~wqnljfa^]_[QMP]fgjntxzyv{~yxxvtwyzwuy|{|}xvsoic_]__XPSZcjotwwvw{~{xtruxxusy}||}~{xsmgc``diaTOR]gntxvvx{~}|~ywvutqoov{{zx~{vuspkgfgic[TQU]hszxwx{}yw}}zyxvspoqvzzyy~~yyxvpkjihfc\VSWamvvx{}yv{~|{{yxwursvxzyz}~|xrmlkiije^UU[dnruwz|ywz~~~}|zywtuyz{yxzz{Ȋyuqonmjfb]XVV^gnswyzwv{~}zwwz{zxvvx|zwurrkb][\ZVY`iqwxwuv|~ywwvvuttx||~{vttslc``ed^ZZcltvux{xx}䆇{ywusrrsy~|}~yvvuohffjic]Z^fpttxzsqsw}~}yurrtx|}~~zxwxtomkgffda]_iqvtqoljs˂{xwy{}}~}zyywtplhhjhe`_ekqqpqokt~|}|zyxvplklmkhfecdhmqvvsw~}}|~}{vuupmmkiiknle`^bjtzz|~}{{}|}uuvroolhimrri`YZbpz}偈~}{z{xusqolkoqog[Z_ktz~}}~~}yvsstqnnptl`[]gpw|~{z~׀~|vrqswwuqqvqg^[dmty|yy|瓑}zy~|wsqsvuspqvuof_bhqvyyz~}xtu|}xtrstqnmpvxvnf`blrvz}z~}|yvz{vrqrrqpmntwwrjb`fox{|~{uێ~|}~yy||vrssrnmqturkb]_jwyyzwr~zz~}yy|{xxyyvronnopnh^XXamsutt򗔓򎏍~}}~z{{zuomlmlkki`YW^hosstu}z{{yqjghmlhlme_\_flruvuъ}yxxrkhimmjorkd__chmrss及~vuxtollootwph`^`dilop’zsrvtqpqtvwwunhb^]bgikoƓysrvusstsuwurokhb]`efjpҖ{vvyxvuqiimnpsuska`bfkq}{|yvtohhmpruvunfccfkr~xsqolnsvwtsrnjgffjq}xsqpprsuvurplhfebgs~zussvusstsqmjfdc_eq~}{zzywtpmkkigcabdh~}{xtokijkjdaddc~~{wtqnmlnnfadec~{xtsronnopiccdg~ytqrsonoppkf`bj|uoprppqttme`bh~wooqqrsuuldaaf{vrpprstrnidcbc㙕zvuttqljgdbb—zwxyyxvsrppmfbcꗖxvxzzxwutssqkfd~wvxyyvvwvuutpke형{zzywqotvwtrqme|{yvomrvxsoqmd|xyytsuwxqnqmd{wxyvtuusrtphр}|wwxusrppuxxtnݗ~}|ywvtqnmnqssr~}|yvuqllnnprs~}|{vmlopruvt~~yportvxxu퓐􈊉~|{|zutwwv~~|zz|zwx{zyvutz||{|zz{|{xz}}{urqwx~}~}||}{tpoxwz~|{{yroo~}xw|Ō~|}~{yxvpop~yw|ޑ}}~~}zwusqqrz{|~񔐌{wvy{zxvsrstu789:99;=>?@><=>?CJOQOMJE?;9::876420-**.7>=<;=AEFDFKPV\YPMLKIILR<=;:99;==>@?=?A@BINPMKMKE?<=<8643232-)(077537=BC@CJORSSRUWQJFIRBB?=>=;;==?BA>AC@AEILKLNMJC>?=96410234/)*.478:<@BBDHIIHKSWWTOLMPGFBAB@<;<>@B@>BDA@AEIKMNNMGA@>;85201494,)*17;<=?ACDEDB@EOSTTSRQPIHEBB?:;=>>=CJMNNOOKE@=<;86435851.,.27;>==>@C@>?BGJNQSUTQFEDB@=;;=:<@CBA?DIJJKNLIC??<:7545663/,-28=<;<>B@>?@BFKNQRRQ@?AA=<=:8;;8:=>@AABDGEDDFJLLGCA>:765446972+*.49;;<>BBA@@BGKLLNP=;@B?>?=;;9;??>?@A@@ACEGILMJHGB=97763/+*+/469??><>ADEILHFJPXDCCB@ACDDA>;;<>??>:=A@AFJMPRPOPI>:99:<8300210.-05<>>?@=>CEFHJMQUFFDBBDGGFC@=<<>??<9=CA@CGKOQOOPJA=;9:<95445540./39<=?>:9=@BFILOQCBBDIKKIFB@@ACA>=;:;;=:7896641./58::866;ABBEIOEBACIJHHGCBCEGD@>=<>@@A@@BEFHKMMGA=<>=;;89740/258::974:A??AGOIDABEDCFHEDEHJGDA??ADA?BCAABBEJLLHD?>??=:99:9753237;=;97;@?>AHPIEA?BCDFHEDFJNOLD@?BEB@BCCBABDGHGFEC@==:898656763225899:?BDHMMJIIJKLLJIKNRSQIDCDEA>@BDA?CECA@FKIE>;;::;:86578740./48:<>??ACFQPOONNMNNLLNQSQNJGFED@>@ABA@EGEBAGLLH@=<;;9778972/.379<>==>@CUSQPQOLLMQTUOJJIEA@AA@?@CGIIGEGJMJD@>;:9:;;:88;8410379;=<;<>BTRPPQPMNNKLOQQNKLLKFBBCA>;9899867;;8412479:;<<>AQPNNQPOPOKIKKLMNNMLHDED@=:=BEIMKHIKMKECB@=9765446;=<7101467;>>@MKMNMMKJGGJJLNNMKGDEDA?==?BFKMKKLNKCBB@=9743346:<<831136:>@@?=KILNNMMJGFGIJJLMMLKHEDDCB@>>@DILMMOLDBB?<;85334679:852116<@AB?>@DGIJMOQNHED?==;85477446763/.29>AA?;QLKNUVTRPNKGJOOQNJHGHFCA@CFGGLPQPLHC?=?>;86763247840.16<@@>;UOKJOQPPONLILQQRVXWSMKJKIGFFGHIGEKPPOIB>>?@>;8654348:521139=?>9UMGISSONNONKMRTUVVURNLKMKGFGGFFEEHLNPPKECABA@;755;>83115:>>9SIEJWVNMMPPLMQUVRPQPOMLNLGFGECCDEFHKNOMIFDBA@;667=@9410037==9RKJMSRNOQRQLKMPQNNOQRPOQOLIFDDGGHJLIFDB?>>:78978:<<731//38;;9UPPQPPQSTRLIIKLMNPSTQPPOKGEFHIHIIGHJHFDA=;<:9;;78:;:8641/3799[YVSPQUTSVSJGFFIORSTSPMMNKIJHEEGJLJJKKJFA<;<<>=7679;<<;612457:_]WSQSVTSXVMIHFHOTUTRMJKLLJHHFAAEHJIIKMNJE@>==>=;7679;<=>932246:`\TPQTVSSYYRNKHIOSVTPIGLLJGEDB>?BEGGHLOPNKFB?>>;8679::;=:42136:^YQMPTXSPVXTOJHIOUXUPJJQRNIEEDEHJJLOMJHGFC>=>:889::;=:52015;]VOLPUYSNRUUPIHKQVYUPMNUUQKGHIJIHJLLNPKECDFD>><:;:99:9:<:62004:_XSRTWYQKMQSQLMPSTSPNNPRROMKKLJHFGHJJLHFDCBA@><8876567632344_XUUXZZRKMPSSRRSRONOPQQPOPQNLMKIEBDEFHLOOKIIFCBA@=9875457842540[USU\^\UPQSTWYUPOOQSSQQRUVOKKHDA@EFCFJKMOOMHB@??><:988:;51331\YST\^\XTUUWXUQNNPRSTTQRTUTNJJGCBDHIHIKIJPQMHCA@??>;8789:952443__URY\[YXXWUTSSRMMRTTSQRTROLJIFDFJKMPPNHGOQMHEDB?>>:7679854466_VRVXYVUWWSPNPOJKRTTQPQPONLHEDGJJLORSJFMPPMIGD>;:878988632566^^WSTVWTRVVQMLMMHJQTUVURPOPQROHDCFIJKMRVMGKNPNJIE>97679:88731466[\YWVWXSQVVOMMLLKLOTXZYVSQRSVSFA@DIKLKPTOKLLKIGFC=977889:85565[][YVWYUSUTONOKILNQUY\\XUSRSWTICBDHJKKNQNLLKIGFGD=:99:;:8578754]_]ZVVYXVTRQQJGKPUWX]]XUSRQSRNJFFGGHKLMLLMLKIHIG>;<<=>>;869:754``^XWWVTRQSSRJEIOVXXZYTQQPOQPNKIJJIIJKMMKJIIE=;=>>??<96:<755a_a`\XTSRQRUUSIDHMTWXVTPOONNONLKJLNMJFFHJLMLKKJGC=<>??>>=:7:<756_[ZZ[XUTTWXYVQIEIMPTWWVTTUROONMKHIJLIECDGJJKJFB?>=>>;9::986[VWXZXUTUZ\[UNHFILNQTWXXYZUPOOMJGGILJFCBEGGIKLKFCC@<==879;;:9<;7SSY[YUSRSXZXRIFFHKOPQTWY[\WQPOLIFHKOOIFCDEEHLMMJGGC>==88==<::>=9PSY[XURTVWWUPKHHKMONNSWWYZVQQOKIHJLMKHEDDCBEJKLKIGC>>=::=<;:;><7QUYYWTSW[WTSQPMMQQNLLSWTTURPRPIIMMKFCBCEDB?AFHHIHDA>><;:98;<;83OSUVUSPW\XTRSTRQSRNMOVZXVUTSTQIJNMKFCBEHEBACGGFGFB><<=;:9889:852LNQSTROV[WTRTWUSTRMNRW[\[VVUQJJMLJGEEHKFCCFJGDED@=<<;988998754HFLRUUTWYSQTUUTROLMPSV\\YXWTPLKLLKHHLKHDCCFJHEFFCBBA?=;8:><::97FBIQUVWWVONTTRTTPLIJMOSY\[ZWSOMKJJIHIMJEDCDFIGEGHEEB?><9<@><=<:FDJORUVURJIQSQRRQKBCIMQVZ\ZVSPMJHGFEFHGEEDEGEDGHFDA=;==;=@>=>>;EDHLNQTSPKJOPPKCBDHMRX^\XSPMLKJIFEEFFECCDDHJGD@=<>>=?A><==;BCFHILPQQPONNOMHCADIOX`_ZUQOOPQPJEDFHGEA@CDFKLGC@??@@?@A><;;9@ADFHKNPQRRPPOLKONJEBEJOXaa]YVUTRRQMIFFGGFBABGMOMHDABDDC@??=;;?@BDHJLOQTUTTSMKOOKHGILNV`a_\YXURPOOMJGDEEDCCKRPLHDADFFDA><>?<<=BB@AEGIMQTWY\\TMMNOMIO\^]YVSPNJHKNOIB@ACEHMQMIECBDEB@?<:<==BA@@DEFJOTWZ]_WPOOPRSPLFJVZ[WSPOPJGJNPKC?>@CGJKJHC@?AB@>;98:<=<<>>@CEDCGLSVVXYURSSRRNJFHNUYVSPSWQLKLNMIB>=?BBCIJD>9768:;;:෹¯¿ʿ߰ʾ𩫲૪ɾ󥧪ǿºÿºÿž̬¼þĵĿ¿$Ŵþ¿ųľųðĿĿ飧Ž¾ƿÿûý¾þĿŻû»¼üľ謯¹ŻĿſžƼȿýź½ʿĻŽźȿý¿źŸžžſºƾÿȾ¾͝ƾ¹ۥĽþ½睞ǀ½¿õÿĿ粵ʀ¾Ľ溸٫Ӳž妤Ѐƿľ½쪨Үݼ몬΀¼ýˀĿ¾ȩ{vy||{{wqqw{rptwxyxuuyxwy{||z|xxz||yrjjp~yrprsruwttwvtvz}}{|zyxxzvqqsz~ހ|vrqttruwvvtruwxxy}~zvtuxxwwxy||~ytrrvvuvxyywtqrtuvx|ussrsuwyy{ywuy~vrsxzyyz~|vpnqx{y~vtrmmpuyyz|zvquwsrtwzz{~xrpr{~{ywrjhjrxx{}xrszsomqy{{~~zwvx}~|~xwtmknrw{yx~}tnkowz{{}}yww{{zyyvpquuw}}unlovyzyz~zwvxx}wnqzyx{~vpmpwyzz{}}{xuuvy~sv|z|}}~}}upnqvvxz{||yvuw{{{z~sllosomtyz|~zxy{}~{~~sjhlromsvuw{ywz{{~||}tichssrttoquuwxx}|xnegquwzxsrtrqstv~|tiiqvz~}wttqopru~yonswz}|wtstuu߄||ᒔzusuwy{zvuuwyxwv}~yxwvvwyxuvz{{yxx~zzxtrprrpsxz{yxw{{{wrmjklmptwyxwuyՅ{xvtoloruvuuttsxywwsqtx|zvsrrsty}}ywvxz{xtssuwxx{~Ċz|}xvvxyywtstvxyssyݎ}|ztqpsuuwxyqpw|yrpqsttvwx|}|pqvz|蚗ݡ{sruvvtuwy|ruxz{|}푌~vvy{|{z{}twz{{yw{|{|}}~|stz}{xuzzwxz}}zxqqx|xuty{xxz}{wvpntwsrsy燍}zz|~xuutsrqpprz~~zwvuuokmos{}|~}{yklhegls{~~zyz}}|~fhfeflsz}|}zz|~~gkjjkosy|z~򤩩񝙗}}~~jmllnquz~{~zz{|nonmorw}}{vvwyklnppsx}䕒}xussthjoqpsy}ؑ~{xvsshmpqory}~~~{zzyyxglpqosz}}~~{z|einqquz~||~yx~glnopu|~|{}詪}|innou}~|{|glmmosz}}zyz||}zzfjlnpswzzwvxz{{}{}yvejorsuvutrsvxyusv{~xgjqutuutrswxwspsyš~ihrxutvxxvuxywsqrv~minrsvz}~ywzywutqtz}nhjmqxywyywxxtswz}kdiotz|sqvxyz{{zxz~kbhnsx|{vljswy{|~}z|ϡnfehnswuoeepuwy{}}nfbclruqjdfrvwxxz|~zy~~le`akrtngglvyxvusrtvvonx~ke`blruokotxyvvurpprspqykfcentvrovzywuvvsqqrtux|~lghkrvwsr{~xutuvvwz||}ң{}|plmotvvtt|}wutuuvx{}~~͇yz{|~~{|utqprstuvyzwvvuw{||{}zwwyzvu|NHHFD?9889:<:89>IKEEFDEGHHMRVY[UMNQPQV]ege]WRI?97:=>?>::>><=>??>NILLD>988:;:856;EHDDECBEGIPVXYZWPNNQW^dfc[TMD<7679:;;::<<;=?AA?JDMNC=::;==<<=@AABCDGGFJQ[^XUSPNOQTZ`dcZPD>:75789:;<==<<=??>=IDNOD>>=<:;>@@?>>?ADIIGHN\`WTSOMOQRW^aaYNA;:77899;=>?>=<<==NLQPFCDA=:9<==>AHNROMX]WRNJJORSX]][XQE?;::;<<=>??>=<99>@@QRTQHFHD>;99=??@?>=>EJOPRY\YTNIGNSUZ`^[XQIC><;;<=>??>;:@BBTWWSIGKF@=:656:==?CCA>=@@AN[^^[WQIFNTX^dc_WQKGB=:89=?@@?=?B@?BCBY[\XNKKF@<8446;>>AGHGB?@??JW^]UQOHELSX]acaYSOIB<88:??=<;<>@??@A@\]_\TOLF@<7348:89;==>?Z^][WRLGC?926=>>@DIKKHECDGOW_[JDEDFMSYZY\]YUOG>;869?><::<>?>=<=@VZZWRNJE>69?=<@DHJJIFCCHQ[`ZIBABFNUYZZ[\ZVNE=;968==;;=@?=;?;:AEFHIIF@@EOZ_[KC@AEOUY[]_`^WNE>;868:86:;:<>>=;<@OMRW\`c`ZTMFB@;;CGFGHGEAAFMU\YKC@BGPUUY]aa]VMFA<867:869979==<;<=OLORV[a_ZWRKFC??HKGGFEDFILPXVIBAEKSTPU\aaZSLHD=757::98747;;:;:9PNKKPUZYWXTLGEGJMLFEFFGLJELUYVJC@ISWTLR]a`ZTOJD<5138:;;:77876789NMHHMQTSSVUMJJORQLFEFDGQNDMY[VJCALVXSIO[``\WQKD<5017:;>=:875457:FFHKQSQQTSOPUUSOLJGD?AOPJOVXSGCFIMQPJLR^d`XPKG@9459:;==<:9::9:=CCHMTTONOSSOQWXVQMLJF??JMJMQURDEMMN MN\eaZQLHA;7799:=>=<<>?<=?DFHMUTMJJRSLLPWZVQLKKDADDCFKSQCHUWUQPTQPZa`\UOH?::857:?@=>?A@==@CFHLRPHFHRULKMSWVRLMOKHGEBDIQQGISWWRRVUS[bc_WNE?;;9679;<;<=??<;=BDHKMJDCGSVMKMOQRPLNQRROJEEIPRLLOSUSSVVW]dhdXKA?=<:9886689:;<:88AEGIJIHILTVQPPMKMKGINSUQLIHJPSPPSTTRQRUZ^dki^OB><::988:;:97765?EGHIJKMQVWSRRNKJHFHLSVQNNJHLPQTWWVRQQUZ]cmmcTFA><;:99:;<<;86765>CHJJMSZ[TPNRSJHMLMTVOOSI@BGOUZ\\URSVXZ_lmfYMJGB><;<;<>=;::;;?EIIHHMU]]SNMVYMINONRSMOUK?>DOX^_]VTVWYZ`kmg]SOJC?<;;<==<::;;<>8:>CGGFMV^]RNPX\QLMOQOMIMUOFADP[b_YUUXYZ]bjlh`WQJA<:88;<<979:89=88@AA8:?DFFHKMOTUTVWVUTRPNLKLQZ_UQVYZ\[UQQRX]_`aa]RHD=459=>;?BBA9;AEGECEHIMTUSSRQQPNNPQNOSX\YWYZY]^XSNOSVY^``a_TKF?89<>><=??@CC@:;ADDCADIKOTUSPOONLLMPRRSTRQUY\[X\_\WQRUWY]]Z]_WND@@<98;>@ABB?99>AA@?CHJMRTTPLKJIJLORTUSPPY_a_\_`[WRTXXY\[Y\]WOEACB@<98:=ABA@?86:=<<>CGGIOSTQLGFHIJMPUUQQU`ffeccaYTSUYZZ\\[VOGCCA?=;;=BD?=?;9889;?ABA=<><<758:==@BDA?>=>57558:=BECCEJPRRQNIGIRXXUSTW[^`bc`]]\ZZ\`cd`[XVURLC<<=>ACCBBC25568;>@AABFLRQPROIHKSXYXWXZ]^_beb_^^]]\_``^\XVURMC<>@@ABBC2567:<==AIOTQNQOKLPRUY\^abb`]ahhf_[Z]`][\]]^_ZWURMD>DGDCA?>>@5789;==?@=@HPTQMKJLNOOQV\acc`^]agjic^[\^\[[ZZ\]ZXURMD?EJJGC?<<=>79:;<=>BE??GNTRMFFLNMLMT[bb`[Z^adikgc^[Z[\[YXXWUQKD@DINLF@<<=>789:;=?BD@@FLRSQLKNMLKNW_db]YZ`bcilifc]Y[^^[WTSTTQMIEBCGMJC=9:;;77899@ACEGHJMRTTPLNQW[]^][YVY`gkihid][\dc\RKORPLHHGECA><=?@?8;:89;<=>@BBCDGJPSSOJLPUX[\]][UW^dhhghd`ZZde^UMPSSOJKLHDBAA@@7:878;>>=??=?BFJMNOKGIMSX\\[__ZY\`dfecb`YXce`YTTURNPPHDEGHGC>>@8;866:@A@@?=?CGKMMKIGJNRUWVW^bb_Z^diiee]Zbda[TQQSQMNOJHIKLIE@AE9<7449BDCA??AEHJMKGGIMPQRRT\djdY^ekliia]cdb[SNLONKKLLMIEBDH78545;CDB>=?ADDEDHLLNQVVW]dkf\^chjjic`ee`]XPKKJIJKKIGFD??B66558=DC@<;>@A@@ABIONLKPYZZ^cie]^acfjjgcaed_^[SLHGGHJIIFDD@>>9:99<@C@<;;==>?ABDJQRPKNWZ[^bgbZ\^^bggcaacb_^]VOIFEGHFFGFEFGFC>78:<=?A>;:;>><<>ADEIMONILTVXZ_ec]]`aekjfdcca\\WQJEBEHGGIHFGJLIA25:=;;>><9:@@>==ADFFGHHKQRSU[cecacinrplige`YXYVRLEAEJJKNKGILPME24:=9:>AA;9>>=>>==?@ADHLPRRSW]egdaainpolihgaXWYVSOJEJNLMROJJLPNG34:=:;?CE<9;<BC<9<>?@@>>?BHNOQTUW^baa_`gkkigffhd[YXVTRPNKJJKKJJLPRQ63:>==?9>@A@@BBABEKOMOSUX_a^^__`gjjheehe^ZXWURPNIFGGFGIJLPSS62589:<;957@CB@@BCBDGKMLNSUW]_]^_`begjheefhga\WYXSOKIGCBDGJLNOON61125797558@CD@>@BCDEEFKTSRX[[\_abbdiheddedb^ZZYUQMIEA?ADHIIJI62--356549;::;<=@FIJOSTV[_cegedeca``dihec`\WQJDBCGHGGEABG:7:;:ACDJQSV\bfiiea_][\]]bjjf`[VRPHBCCEGGEABH98;=;<>;;BC>=??@ACDA@BBCIORV\bhlmhc_\[]_`fmmhb[TQPHBBA>@CDCBDH:;;::;<=@A@=;>?==@CEDDFGGIMPTZaioqmhea`cghlrqlg`VRPJC@=89==@EHH߱Ƶüƿ´⳸ϸƽ¬ȿ綷¹żøǻŽǷǾ­ȸ«ԫ¶׹»𵳳ǽȽ¯ƺĿíȼũ㦤ǥǽ&Ĥèƫɭ¾̯ý츹ɼ˰Ľͯǿʯ½˰ï¿˱൲¿ʱ¿̱ļϳǽԵԴ¾γֱϰ벰ҮŮ¿ѭ믲ΰĿĿʲ¼ʴ¾½δδ޲ÿα¿ϮՌҮذڳþ¿ڶžٹᮭǿӼ¾Ǫμʸٽͷ۪ƀθȿι¾̸̴٧¿ҳӀ~}{{{y{~~~|}~zxx||}yy{~}~{z{~z}{ytux{||~ׂ}}z|}{sqtwz}~|}vrtw{}~~||І}{wwz~~}|{zڄ}{wux||}|zvtvyzz{}|xvy}zyy{~݉}zw{~{xxy{z|{xz}zyz{|zvuw~}|}}{z}}{zyxy{|}}ywvw}{|yyuty}~zuuw{||~}}|z}~{wwuuxyyusstvy}~uvwxwvtsrrqv}tuwyzywutsrnqxvwxyzzwussrpqv~~y{xvxwtqppruwy|~xywuutrrssuyy|~؜uuttrqqtwxy|{y~}}ϣsrrqponqvy{}zv{sqqonnqvz}~zvy~vsttppsvz|{|wuwxuvx{~}~~~xwy|}}~~}~}~~~~zyxz~~~}|􄅃~~댑|zvw}}~~||}~Kzuuwzyw{}yvy|}xuvxywtx}}ywz}}xyxxzywvv||~wzyxyz{xw|~vwxyy{}{񒙞uuy||}~~~vv{}z|~{z{}~~}{}|{~~|y{|vtuxzxw|򌒙~~}{xyytrsvyvv{~}|{{yvuuvvxyyz}ϡ}|{{zyxvvyzy{}~Ёz{{zyy}~}~}|~wyz{{z{}~~|{~vyzz{{zz{}~~|x{~~z}|{{zxxz~|}~{z|}~|{|{xxy|}{||{z}~{{~~zzyz|}|zz}}{z}{xxyz|~~}}~|zzxuvx|~~ْ{||zvwyzyvtty~x{{ywwxwuqmkt}Âwxwuttuutsrqlir|󇌑{zwvtvyxwwurnlsz~{yx{~~|trttw~zxz~}zuuvvx|}z{~zwwz}}zwuuvvwvsx~󯌇xttvyzwtrrmkpstyxsrtvxwurqqkipuy}}xttuwxyxuttu{~|땔zuvyyxvuux~}xy~}{xwvussv~~|{ywspqu{}z{}~}yuqruy|~~{ut|}{yyz||zuu}݃}||}|zxwy~|}yx{z}?@AABEFFDBAELRVWY_irrjYOLHGHHEHLLIC?<@FGGEEGNTPMMLIJKNOONLMNMOS@ACCACFEDA??CIOTX[]gqphXNIECDCAELLHA<;=ADFEFHOSKGJLLMPPMLMMNPQ?A@@ACEC@?@CEGLSY\]fpoh\SKFCCDDEGFDA>:;>DGEFINQKGJLOPQRQMKLMNPQO?B@?@AB@?@BDEFJQW[]fonh_VNGCCDFECCBBA==?DGFFILNKJKNQSTTSQNKLNQRPBDDA=<>?@DEBBEIMRV\emnj`XQG@BDEDCEFFDBCDFGGHHIKMNOPQSUVWXTNLMQSUDFHF?=>?ADD@@BEINT[dlnj_WQHBDEEDDHJHFFGHFEGGEFHLNPQQTWY[[VOMMPTXDHLLEBBA@A@==?AFLT[dkmi^UOJGGEFKMHFHIJEBFFABEILOQQTY\][VPOPPT[CHKKEA?>?@@>?ABFLSYainlbXOJHFFGFEKOIGGIJGFHFCCFIKMNNRX]_]XSTUUVXCGIHD?;<>?@@ACDGMRV^fmnf\QIECDGGEJMJGFGIJJHFFGIKMMQW]`_[WXYYWUEHGFC@>>??@BBDHNRT[bgid]TJA?@EHIHGGFFGIKMLJIHGHLSVUVX\^_\YXXUUWEHFDCA>?@@BEHMQSZbghc\SH><=AFKIFFEFHJLMMKIIMVXVVWZ]__\[XRRWDFDCD@;<@BBAACFILOR[fnmbWLC=<GMPNKORQOLLPX^bcc_TQT;=<;;<><:;=?ABHMMNQ]jqpeVE?>>??AEILKIEDC?>DIMKHOSQNKMR[acbaef[TP:<<:=<:<>?ADINNPS\flmi`SKFEDBBDHKLKIGDA@CFII4LMKJKMQZ`cddfe]UN;;=>;;<;;>?>@CIMNPT[bhllh`VMJHECCFJLMMJECBCEFHIIHGHLMPY_bdfec_XN<:<>?@@=:==<;;CHGKT\chkljdYNHFFDBDGJMPLFDCBDFFEEFGJNOQZ^^bfece_T=;<=@@?<:<<:89@FEIT\bimnkeYMFDFEBDFHKOMHFDBCGFCDFIMRRSVXX]ddcgbV@><;=<989;<::;BGFJSY^hoqlbUJEDFEDEFFGJKKIFBDIGEEHLQUWUOMOXbccfbV<;;<><889<=<<=AFHLRUYaipmaUKHGGHHGFFGFDBCHFDGJMQVWVRPRZccbgdZ779<@>:99=?>==@DJORSTZbnndWMLKIJKHFGFDBAABFEDHLMPTUVYZZ_fdcgf^568;=>><;?A><AB>==@DILNSZ`fmqoeXPLLIEDDEDBABEGDDGJMKJJLOSV[_befhgb_^:99;>@ACCBAABDGJMPU[ahlmh`XPIFGHIJG??DEDAAFMRNJIKOTZbfecbghcaa=;:;<=>ABBAABEILPUZagjjie]RHEGHIIE=?DDB>?EMSOLJLQUZchfb_eiecd>>=>@@?AB?=>>@CHMQV]chighg_TIEEB@>@CB@=?DJOOMOSTXaeea]digee@@<;@@>@A?=>>??@BFLQU[agihihbYOHEEFFECCBBA?@DGIKMMNR]cda^dhgffBA:8=>=?A@?>?@ABADKOSW]fiijie^UMGGHKKJGCDEDEFEDHKMLIJNZacb`dgffg?=:9::>A@@?>>ACCGOPOT[ejkkie_VQOKHJLMKIKMMNJHKNQQOOS^cabeggedf=:99:=?@@?>?BECGOOLQYcjlmjf`VSTMHHJNNMPRQRRNKMPRTTW_c`dihfccd<:88:=><:<>>?ADFCDJKLQXbimomibWSSNIEFMNMOOMOSPLNPPSVVW\`aflhdccd=;;<<>@<9>BBDECCFIMQV\bhlmibYTRNKFFJKKNOKLSPLKLNQTUW[^afkgcdd>=AB>>A=;BGFDAABCDEINQSTX_gke_[VQOMKIIHHMOIKSPKFFLPQSV[^`eiebffd<;AC>=>=>BDCA?@BBCCHORTUX]eic_b[PKJMONJFLPKLSPKEENQRTW]`bdfdcgif<;@B><<>?@?>=>?ABBDIOSVWZ^dha_f`QJHNRSMFLPNORPLGGOQQUY_bbcddeikjA?@@??@@?>>==>?@CFHKNTXX[aeg`_eaWPLLNRPLLMPPNOONMLLT\`a]_bdfjmpCA??@AA@><<=>@?@CFIJMSXX[ade`_ca[UPNOQPOMMPPNNOOMIHKT^a`[]bcfjnq@?>>@@?=:9??@><;;=@DEECBCGLQTTVY\_acca^YVXVMLMMLIHJIFGHIKOV]`aabacimm@A@?=>@><=>>BFGGCAAFMRTRSWZ]adfd^YVXVNLLJGCBCBBFKQRPTY]acedaainq?B@>>?A@??@BEIFCBDFHKPSTUVZ_`bdc_YVXWRNKIGEDBABDJRSPQV]beggcbhlm?B?<>@BAABCGJD?AEJJNQTUW[__ba[VWXVRMIHIGCCDEIRTQRV_dfggdcgihAB=:;>@?>ACADHD@@DJKKLNOQVZ]\^dec]XWXXVRKHLJEHLIIOTWX[bffdbabeebAA=<>??>>AB@BDB@@BHKMKKLPUY[[^fhe^XVVWVSLIMKEJPLJLRX[^dgd`\^aeea@?@ACC@@AB@>>??ADIMJIMQVWXY^hje]USSTSQMKLJEJQOLJNVZ^egb\X[aijeB?ABB@=>@AA@?@ABBFKKOSVVUV[dgd\TSSRRPNMJHMSPNMPUWZcfa^]`djlhD?AB?<:>=>@?=<;;85CEFEFFEEFHNSSW_aadd\WWXXQKJKMOQRTWXX[]Z[`bdlrsrq@>><>BA@AA>@DCBFGEGIFDFHJNRTVZ\\``WRRUWMFHHMSQRXXTVYZ]bcclttrnDDB@??@ABB@ADDCAEIIGEFKMNPTY\\ZTPOTYPILLIMQPPSUUVXY\bbiqsrnIID@@?=?AA@BCB?=BHKJDEKLLNRX[\ZVSPOT[TORQMNPOORVWXY\aagmrrmMHC><<=?@@?<<;;;?@@>:9:9;?A?@DGIKKHLPQQU[[YVTSUXXWUUWXWPNSTRSW]`^aelojgfKHD@>>AA@<:;>ADDABDGKOLEHMJJOU\ZVSSUXZXVSSUSQSUVWVWY\^^bhkkgfhJKGC?@CCB@>;::>ADEFDBGKOLGILIHLS[XSSTVWXVUVVTPNTXVWXWWY\`fllkhghJMJEAAEEC?<:99<@BEJF@DIKKLMJIKQYVRUVVUSSU[[UOLSWTVYVSTYbinnlkifJLLIDEHEAA?;88AABDFEA?CEFHJFHQTRUX^^ZVSTVVWWRMSWWXYZ[XY^chjjigdGDFGEEGDACDCDEA>?ADFECCFIKNOJJPRQUY[\\ZWQOUWVRPUVRSY\]YX\cjkkjhFCCDEEDCCEHIHB>BDEEDDFIKLNPMMQTTXZZ\[XNJSWUSRVVPQX[]YY]dkkjkkHFBAEFEECDJHDAAIJEBACGMLHHJMPUY[\[ZYZYVLHQUTUUWVRRVXYX[chjhgikkƴ^-#$%'4B=636<@A@AFLRMC1())-9TTŲ]-&#"%3B>724;?A@AGMRPG4(%%,0ýĿƵ`+$.&!#/<<846>BDAAEJPNG7+%%*+¼ȸb+)3&",8;947@DEA@CHMLE;0'&)*/1ɻe0)1""-9:836@DDA@CHKJE>5*&(+0-ƿɻd.*0!#/;;836@DDA@DHKKHD<0)&)..ĺǻa) +0##/==936@DDAAEHLMMJC8-#&+-54ùȾ^% ,1# ,:;735>CEA@CGKLLJE>1%$&*/1¹["!-1 )78525=BE@>AFKKJHFA5(#"(,.¼X$./(46525>CC=;?DJMLIEB7)"!%)/ƿT &/.)46525>AA<9<:9>FHGDBC>5(#P-!(//*68757;<;<:7=::96;DGFECA?2%ʾj4#,10)49:8:@?:539?EFEDCBBA6* ģr5"+0-+58878<:6448>DGFCACDC;/"˾Ũx7!*-+*48867:84358=BEGDBBCD@6%ƹ|9!'*)&06978<95349;=BFFD@@CE?)ż= "#%.3557;:6348:;?CFE@@BFB0 ¿¾@&.0025::84489:=@DDA@BED8)? *33225:;;6469<>??>=?DFD=/¿>$.663127:;7558ABAD:$¿Ḷ¿=)043.%$)05568:=><;<=>>@F>)=(/41*#,44358;==99==:<@GA.¿8)14/'#,54358;==98=<:=AHC2¿1+12+# &.54357:=>:8;;:=BGC7¼y-!-.*$ #*0421467:;:9:99;?DE>ƿv-$/+!"*/2103568::;;;>ACþw1'/2(!(,/0124779=@Eľj% '/.$#.1011364247:;;:9:>E¼_"  *.)"/10112464246987557>p?'!(02%",21-/0//113798899:=>=f8&$-10!%-41,.0--//06987668<><¾g9'&/.(&.52.01../0489989<=;ſûe8)(0*!'/43/120/00147:;;:9;<;ýȸY1++-$)131/122343368::9779;<ɰN-.-* -3210123454457898779:<ýȤpC,0.&!052112212234579::89:΀¼Ř^8(0,!#03/0220..0112246:;;77;ÎO0%.)!%.1-/21/,,.012236:<;66@MUxQ'3?.%,B\a^UV_`__`bfkopmaJ@=@JAvN&!6C.#*@[a^TU_ba__chmoppfQC=AJO}~tJ##8C,!'>Y`]RR]cf`_djppnpiVG3$%('.MXTRUWX[][\_``ab~y}yK $1DD/&$$&'1ANVUSSUX]_ZX[_bba``ḁ|rE-NMHHKPRQLJSYXZ^\Z^`aШT3/6AB:* #/=MMGHKOQQLJSZZ\]^^__ǩT32:D>2& %0>MLFHKOQPMLTZ]]`b`^^Q45=E9)# ")6CNKDHMQQONOTY]^]ac`]]sJ48>A3$ !%-=JSMEINSRNMNSX\]\`b_][`B5;=9-"!'2DRZSHJNSSOKKRWYZ[]_^\ZR;3<9/'! '3HUZSHHLRRMIIQVWXZ\]][ZwG62:4&#!&3IVWPHGIPOJHIPUVWY[\[[Zq@6581%!&4JUUOIFFKJFGIOTVXY[\ZYWk:664.&  !)7LVTOJFEFFEGIMQTWY[\[YXg645.)&!  '/RYSNHFFEFGFEHKOSXZZ[^xS42/%!)1>TYOHCCEGGEBAIPTUUWWTU[gI3-*%")3BX\QHCEGGFBAIPUVUWXVVZW?0)&&!!$)6F[_TKDFHFFCHNTVVXZYYګsD1*&$" "'-:J\^RJEDDBBEINTVWXXĤi8(%##! !'/=L[\RJDBABA@BFINSVVWWVd4$"!!#"$-=LY[RH??ADDBCFIMRTTVWYXSa3$##"! $.>MXZTI>=?DC?AEILPRTVWXWT^2&'&$ &1@NXZTJ>;:9==BHKNPRSUVTTǪwQ0&%" $+4DRZXNE=989;?DJMORRTUSRRqI)!##"!#+6HV[WMC;779(#&&# !+:LYXSH?89=AEIKMOQSQNMNRQJVWQNQQNLLOPNORQOMMNLHFJVakf_al}nz̻TVQOSUTSQTSONOPRSQNHDEJT`je^_h}yj|POPSUVTSTSONPX]XSMFBCHQ[ca\\eysczʽNLMPRTTSSRONQ[b\UMGCDHNV_`^Z_qk]{ŸPKMPSROOPPQV[\YQLHGHJR_ddXVda[ʹSKMQTTQQRRQPPRW][SMHGGO]efXS\\κUNORUWYWUVVROMPU]]SKEDDELYbfZTX[bѽUQTVVWYWTVVRNJOV\[RIBACFNYcf[RNUgƷTUY[XXURTTQLHOVZXQH@>AGOYcf[OEQnϾWX]`a^WTRUSJGGIMRSOG?=?DKS^dYNESsįYY]bgaVRQRPHFIJKQSOG?=>AFLZcVJDX|ʵWWZ_fbUPNLJJKNQTWVPG?>>V@DWeSED]ϾTTV\geXQMHHLPSVWVRLD=<=>?>?Qb^bvŮOO^jmgYMFIJGGJKLQPHB>?AA?=N`biz˳NL_lldUMHIJJLMMNSQG@;>BBABM[bl|͹RP`kjcXQMKJJMONNQOG?:=@A@@IUbo~XU`hgc\WSNJKMQPNNKF?9;=>=>98;<>JZhonpsrrs{ȭfhhgf`XWXWWYWSRQOKDA?:8<=>K[hnllmnpr|ɻγfghhgb\[\YXYVPNNQQLGB;9<=?KZgnmjimsvóӺfghhfaa]YWTRNMQRPJC<9;@FMU`hkidjsxõgghjhdeea[TSTQNPQQLD=9:AKORY`fd_fq{ǸՀghghmh^_bb^USUSQSSRNGA<89:@LX[XPPV\h؀egfedb`_aegea\VSWULEA@?><;JZZWTPPYkdeddcdda^aehe_XTZWJD@AA?=>LZ][XPHXsccbdhjib[Z^eea[X^ZKEDCB>?DOZab[NC[}֖edfiqrmcZXZbeea]ZULHGEB@AGR]b^PJMgihjovvof]Z[`egfaWPMLJFBBDIVa`VDH\wonnoqpkifdbadhhcXRRPMFCDGKZdYK?LlqqpoomkkjgacigaWRUSNFACGN\eRDDXzorqoonljjg`cke[RQWUOF?>EQ^cLCSjoqnmoomjghe_`dc`XV[YSMHDIU\]JIc|pniinnifddc_\\ch`]^[WWUNPXZXOVtƿliffklihfcbccfg^ZZXUUSOR[`c_gƿggeehighgbaeghhd\WVUTRPNT_gmmuƿĿځehfeedbcda`bdeeb]XTUVQNNVbjot~ƾeiihhfcdeb`_`bee_YTTVQMMUdjowƽٹfilnomiihd`\]`hkaYUTTROLTdimxżhknomkiieb``bhj`[YWUSQOWgjoƼklnmhffhigeedee^[[YVUUV]ilrȽkljgcabglljfa^]ZWTUW[^_bhksɽmlhc_^ahopomib^ZXUPQW^ceffjuȾĺqoke]^fmronnomg`[VPRW^dggejwƽлpnkg__flpnmnqrkc\UORYafigcm~lkkicacgkllmoqkb[TMR\ejkf_p}¿kjjigfgkonmlnpia[TOQYdkhb]o}~̿kjjkorpmlmng`[VRRWdke`^n~|ǻhikmmlmnnmlga^ZWY]fjdcgs{z~ø׀fhknnmlklopqolgb^[X[afgcfoy}xw|hhkmkjlnprttrng`[WTY`cdcht~ztsx¶ggknkknpsuvvsmga\WTY`bccitwpnt·ddkolmqrsvwwrkhe^YVZ`bceir}umkrbckqponopstvrljg^YX\befdis}xokqûbcjoqoklnprutolg^YZ]cghcivzqkpĻπfegikllmnosxxsmf^Z[[]dhciyyngmʿgcdfhklnopsyyung`\ZY[flfm|ujemĻe^bfijkorrswxvqje_XW\jrms{nedoӾĿʾ6܇!7P8ّ;8e8= 9{(9Q:;:p:&3=3$=$:1=( <(0<'1<;$/2>>7!+.;'*K:!%/.6!)$9$"7 #,(7'22 4&-+7!%!7 #$3$3$$2"#)6' %)5/'56%%449*#(4<-%)+1>/')*1@4 $'4B8" !#4B;% *.2A='  +)2?<* %/(2><+ &102>=, %13J0=<0$ ()10<:3( "#)0;93* #&/0:72) %+J5096/% &.?60:7-# "+:30<8.# '5/0:7/& &240960) '1-862* )3-640(  )2/,42,%  )27@+52,$  *379 *63+#  +476.41)!  *484'-30'  +7;5+*'3(30%  /;@80//3(40$ 0=C;2.+&'61# /=E?5.)#'5/" 1>FC:.'$*3,! 3@FE?0'%#%1+! "5@DE?3+'&,3$0(  #7ADFD9/&$$)-% "7ADIJB4$'=>3=3I=I:Z=LB<FQ<@N_;;JPbb75DH@60:?r@6*29PY/6#(5HK9 #1>@H7!,5:HC7$*5D@@@4 $3?<7$"1977)!-4BI3/  '.DjII24""(9E6;$%29d5D*!$-1:5M1#!)-9Q4T8#$+=J4YA& *;B@1\I+(9>@1\M.(6:4\P2%164`W7(2QVU/c\J -]VE4#(?L[U,[UD2#'APbyUU+XP>-"'BSai@*UK8(!&CUbeF.TL8("&BXecUO-SL7'"%AYhcVQ+CC(PI5%!&@YkcVPGHCC(OF3$'AZlcVLCDF'NA0")D[kdXIABF'K=++DYii`LACDh)G8',DXhmgPCA@B1%B3",EZjnhUF=:=A11$>.!-G\knh[L;6873#;+!/L_jlidT:354*3#==>==:=<<;76669774773󥕍26|554Ħ4̰1ӽ1Ȧ4Ѫ4ֱ/ٵ2ڷ2ں0ٽ0ٽ0ڽ00§ı000ª0ª--Ҽ-θ,ʵ+dz*űΎ.ï͹-˺m(˾ɹ(ź̿'쿴~Ƿ'꽲˷)꼱ѻ%弰ò$鸫ʸ#貤Ͼ#=A<j<0 ;p#;B;b:(9\9ԏ,9M7z17X7݆ 7 7A6s-6M5h 547 4_4֏,4;4N4m2: 2T2q2׎!2&2-2 62 H 0 a0 l%0 t+0 70 I0 a0 ׁ0 ?/ σ0/ ^. K- ֐7, m'+_+&+i()^)1 (l&(T'()('$#""#&((%$#"!!"%&'()&'**)-/,'! ""&7Omnbw{++'&))('&$#$%''&$##"#&((*+''*)'*-.*"!%*=_bXl))&'*+*)(('&&'&%%$#%&&('$%(+,( "$0HOPaw~''&'*+*))**+(%$%()('&&%#! #$%%$#""'*+&&4Ec((**)% #(+,--,+**('&&))('&(**,+*,,*'&%&'))*,)&#""#%$$%'*8G@;=Z%&(*(%"#&(+./.,*++**+-,'%&(*)*.,((*,+(()*+,,+)%""#$&()1:854S#$')(&$%&'(+.0-,--+,,.,(&'((*-+')+/.*+--.-,,+&#""#""&('+/0/,J##&(('&%+0/-//++*)()('(*,+)-020,-00/.-,+*'%##! $&%&''&Aq#$&(('))'%#',-.0/,++*)()*,+)+.11-./00/.,*)(&%$# #%%"! 9g%%()('&(*(&$%'+-..-,+,--,+**+,-+(')/1.-,.00/,*))(%" "$&&% 2]((&),-)'(()*,+*,--,+**-.+**()-/.,*/2100.--)#! !$&"*R))'&$&),-(&(('&&%'++,*./*)+*),-,)'.321100+%#""&$#F'&%%$'(%##$&'&),..-,+,.-+,,))**)*)'##+131,-/00.*&%$ !#$'#9'&$#$##$$# !#%'&(,./-,+-0.+*)())+*'$$+131,-/0/.-*)'!!"%)&/(($!!"$#"%%! "$%$%(+--,-/0-*(''()*,,+**/110/011.)# "&)'''%#$$##"$# #$!!"'+,,*+-+)''))(&%(+,-./0/0223431.+(#"#%%&&'&##"! !""'**'')((),,)$!%)+.//-/344676532230*%!!''&&('%#"!"$#   $')(()('),./-(%'()*,./1233565311243.(##"''&'((&#!"$'%!   "%&'(('&)+,./,)**)*+-023212332001331-(&$!&&())'$!!$&'%#! ""!"##$%&),,-01/.-./1121/.0121/)$#''))(%"!"%&%%$$##"#$$##$$##&*,.00.-,,-../011210/01221,('!(()(%"!"$$#$%'&#"#! #&'&##"#%(+-,,--,+**+,.0122100.+$##()'$"$%"!""#%&$"#""$&'&$$%##%')+,+,..--+*)),/12232210,(%$('%##  "$#""#$&&%$')&&(*+,,-0/.00.,+)(+.1221320-,+  ! "#%&&%$$)-*))+-./00/--/1/-+*+,.0112121.-, "$%&&$$%*.-+**,-.11/../-*,//102120/-+##! #!!#%'('%%&)+--*('(*.0210-+,+)/521441/.0223420.+(%%$#"$'&$ "##! #%&())(%&)**-.,*(()+-/0/,*+*).22541/.13345421.*$$%%'()*+(''(*(')*)+,*'%',,+-..-+**))+,-,+**+,/1320//343465464.""%'(('())*+**,,++)&#%+,+,,+*(()**,./.*))**+-//0112345971#&('$%&()*++**,-,,+)&#%*++*('&&(+,+,-00+))**)),-.01//00136:95"&$ #&$&**(()*,--,+*'(*)'')'&(+./.+(+,,+*)()-//..//./147;<;"!!$#$((&'()*,-,+**+-+(&&((&),./.+(*-..-,+))-//.-//0147:<<#"!#$%%&'(**,,(&*-1/+'%&'()*+,,.0//-+*+-/.-/1224778:$$!##$(**(),/0.+)(&'))*++,-.//.,-.00/024313568:##"!  ! !'*)('(+./.,*+*''))*++,++./../01221252/1357: "#"!!#$$%'+,+**+)&&(('()+*)(),-.1310/03212352.02456!##!  "##%()**)&')(''(+*)()*,-132/./3223441.02343 !  "$%')**++*)*++*))*,.,++,--,,-024552023321!"!!#$%&&(*))+,,+*)*-0.,,++,-..024543223320#&$" ! !!%('(**+)+-/-,--/13421023320123321!#" "%%&'*+('),.-+,,-/233200123311344  #$#!"%)+&%(*-,++,.012200123221//355('" !#$%%&()'')*))*-/0122321//1220/341/.*&"! "$%%&'%&**((*-01121134320..1331033/..,((&# #!!"#$"#(+,)(*,/00//1210//134410221--,*'# !  " !! !#(+(''),.//10/-./1331002**+--,+(&%((&!! ! #('%%&(+-/011/-++,.010/-.2))((*+,+*((**(%#$$##$"!!  "(&$#$%')*+,-,++-//-.0))''()++)(')*+)&%$"   "&%#"!"$%%'())*()+,--,((*)&$%%$$%'*.0.*&&'# #%%# "# ! !""$&&%%$!!"&)*)'))()+*(('$##"!"$(-/-)''(%#'))'%#"&&$"! !!"##$%%$#"!!"&))',,*)*)'&&%$$##!  %()&$(('&%)**+,+))'&&'((''('()(''&()+-.,+,520/144542/-./-.//-..,-./012334;?<7/+(''('%#%,8HF>M]chi\OVakrw552123447862.02101100/*,01100//16<@>5*!$&&%%'0BB;FT_fg]QV`mtv6644664458873135530-+),0/.--,-014;?>2$"%'%)475=J]hkaTQWjsu664487445776424677630,**-0.,,+-.-/5;@8+#!$#%*-05AXglcTLPhtv4311663225653345431120/00/-,-..-/102897/)& %&(+/:Qah`RHMgvz32//34311454454312210110.,.//-+./--047643-##%&&(2I[d^RFJev|22001231045576420012/-./-+*++-07=@>6*!"&&#")AT`]RDFasz5543235324457764210131/..,+*))*++,28<>>81-*)'$ $8JXXPA@Ykt77645654435899767764311331/.-,+*)*,-+*,049>@?;5.*'!"0?NRO>:Pam66543345677876655420/..,+*+,,-/137<@?;62.(&)5FON=7HYg33234556776435788667532110/--./0/016;=;852-*&.?JM<4ARc..011234455323455664247<<99887655664210/110/0244331/.,'+8CI8/:Md,-/0025576421345564369=;78:;::87899743232/.023210//.-*,3=B4,4Hc..011366864123559<=947;=>=;889<;65653//23442//0.-,.17;0).Ca00344698667522355334689868;>@A@><<>=78;9633542210//..//.38/()=_235679;85457633465113346899=@ABB@>?=7:><:774100/../0/-04-'$8\665568952566557997200259;;87:<=>?@A@=9:==<;:8520.,,.//.,(#3Z:9645653145448;;952148;<:767889;>@?=::;=>><:852.++-.-./.*$.T=<744323327;<<:648<><766544578;>>;:9;775423568<=;98;?BB@>;:72/,,+()+,*!"B7755789:953456558:;;:;;<;9887534667;<987:>CDB?94/-+'&'(( 9986577533454579:;;:9::76997449;988;@CDA>AA;740-*'%'($/::757655443234678:;;:99::78==:649:87767<@CA@DD?;82-,*&')("':97664357841133457:<<989889=>=<::9544347:>ACFHFA91++*%!8754454346740011258::889889:;<=<::987654469=BFIKG=4--,+*&54102232320/.002556899:;;:988657:==;:95568?==<98789=CIIEC@:4/*(&%"441001442.,.-,-/00.,,/101479:989;:868=?>>=<98;>CEFJKE=4+%$#!651//13320010/.+),../1576569=<:77?AB?<=?BCCFIIE=3)%# 650.012112201220.-+),..//243347:<<98;?A?>?AEA>>@AA?ADJKF=2+%!21..1210/10--0010/-+,.0012248<;;>@?=<=@>;>?@>;;>FKKHB5*$32/.2310//-*+//0.++,.001100/16:==<=@?><<=<<>ABA?>@EIJKI=2*#66103421/,))+//./-**,-/02210/-,.148=>=>?>>=;<=@BDFFGFHID<3*"43/-12210-,+-//1.122101/--048:<<=?>>=::<>@CCDGJKIHGE@81)0/,+.0210//00/034321//23211330/047789<>>=<::>?@=:=??@ACFHLPNKLIA92.--+,.012475112455434675247;964456789<=<>B?<>??@BCDDGMOOME=44322002331//13698765567768;><76679<;9;;:>@BA@ACGLQQNIA88656775454211236;:7765679::<9668:;<;::977;=>=<;>ACCAABGLNNMG<;;548:;:986334436<:7886547:9865469<=::974348;;98:@EHDAACFJMQMA<;769:98778764598776654565544568;;:98764348;:879=CGEDFFEEHNNH77558875569:99865578765543321257889:97665569;:878:@DCEIIGDDKNL,,-.258632237:989736;:87545631/03698788789879=?>@EIKIHJKJ**,/24420//38768747;<;97567420027976689866788:;::<><=@FKKJJKK21.-0/./0.-.142246889=?<9877543347975579754589:;<==>?>=<@EIKLMO320//.++*-/112477:=<;:9877655898678::9669:<==>=<@BA?<>BEHIMR220/-+)(&',./011244579;<;:998779:889:;>=98:<=>><;;@DCA>>@ACEKR4320..-*'',-.//01346799889::99:99:;==:9:<>?><;:=??>@EJO21/--/1/,((+,--./024677689;;989887789:;<<=>??=<;;<=>??>=>DIL++))+.1.+))++,-156899:;:65654469;=ABA?=>??>@>=<<=BGL((''(,/.+**+**)-0246674765668:;=AB@><=>??>?@>>=>?CFI((''&(+--,+**)&%$%'(*,.002335899:;=<<;;==;;<@AABDEE,,)&%%&)++,+)%$%'()**,/-,/12577:<>>=:;??=<<==;:@ABCEFF22-)(&#&))+--,*''())++)*.+)-0134337:==:@B@>=?>;:<>?@@>?AABDFH98741-)'%%&')+,,+*))++'(,)'+-.-,-/48<==::=?@AA@>==<;=>@BB@?BDG>><84/+)'&&')+-0/+**)'(+)')+,+)*-059::88:<=@A@??>><:;=BCC@>@CEAA@>9440,+)'),//,++)'')**))*--,,--0554459:8;=;:;=?><;=ADDB@@BDDED@;789861.--.//--)'(()('()++,-/232236647:878;>==>@BCDDCCDEEHF?:88;?>855430//+()('&%'())()+-/012210366568;;><=>?ADDC@@?><<=;8776779:887640,-/.,)(')*()+,,+*))+-011378876678:=??BBA@?>>:899879:9645675269630..//-+**,+'%$%&)*+-//.//02466DDBAA?;9987699753345549<854323320--.0/+(''(+,,-/..//13566FFB@CCA>;865567764331011695475345665678853211574576688657:=??>dM=-!)369;3*/6;==ˣyhO6#'05781)-4;>=ݢzjJ(#)39;3*(-8>?˩}}}^6'&1:=6+%'6>@󪫭ӣunp~nO6(/6<7.&'8ABrjs{xfH20396/%&8AB㨪rjly}w\A3164.$$6@B䪨㪫~~{eK4+11-"!2nDmJϨýkQ»u^þoҬþ|诰Чþ󱯭շ񮭭Ế򮰲Ը޸񭬫ù귻櫪󳴴ᄐ츷㵲⮯漿ì󱲴ĩ𱰰Ḭ̃Ŭѯ²󭩪̮߱ڪ縺竬͵٭貯ݰ½貰綴¾߷𧩬¿ʽĿüְľﳭԯ¾ûΆ˵۶׶󤥨߰þ½½ÿ𪥧þٳϭ¹»֢üļLJŽžxo¾ľdڦĽ½YĻNzż˽Bm7`ú෼-Uº%I{þÿ ;qǾÿ3j槩ƾ޸Ŀ/d駠€½",Zÿ¿%)Oqþſ&'@]|Ŀ¾%&7Qs½$%5Mnǿÿ½%%0Ef}½𰱱(&+<\x¼,)*7Ur1.+4Mjx96-0C]z}w{»Ϊ<:10E[r~xf[cp~Ā½/.27:ERl~zl`Zblvý032215=AHXhyvg]Yblu~243315;<=;Hdvvf[V_is{¾343235884%*E_vvf\W^fnv33214544-%Dhuf]Z^djrz/.//;.,+&":Xvte^\^dnv}Ľ*(+,*'%%$(7Kk~sc]]_eqz%$%%$#%(+().6Cf~}r`ZY]dnw~'&%%&(,/1/035=^y}s_XX^fov}-.+,0587422547Uo{t^XZbjrx}z|}~Ê{wvxxwvutuwxx{~||~|~~{zywuuwyzzxx{}~|yzyvuvxzyvrxy}料ą~y{{wvwyzxto||~{{zwuxzywt}|{zz{}}{zzwtwywur|zvsqrv||yxvsvwtokxwsonqv|~zxuqsurpostqnnry~ↄ|ytpqsqrtpsompv}߂~zvqrrtnsonrx~~}}{wttssrsotrqtx|wrqsy~|zywvtsrnrqquy{upptz~||}{yvuuloopvy{wtw{~~{vx}~~{yxylpqrrv|wtx||wrnjmvz|{yzzykqsrnszvsw{{xqjfdgpux}}yw{|ykqomlosrqtvusomllnrtw|}||}{yyz{hqmjknppoppqpoprsttuw{|zy{}}{yxzbpnllnqomjjopqtwwvvx{~ywy{}~}zxv[llmprplggknquxywtssx|~zyz{}zvrSgjknqrqmhfimruwyvpmmsxy~}{zz|ztoLekmmlkmnllptxxwuqkiiputw}}zyxz{{yvrFbknmkhmrrtvyywtpmjggmrqrw|zwwxxwwvt@`jnponsy||zvsqolklheinopq}yzzvwxywsrs:[hopqruy}~yupnliikgdgjmnmxxvursvxxtsu4Tgplouttwywtpnkfegfdeglmlqz|qlmnqvxxy{+Ialfjtvuuvwurolffigddglnmt}~uqrruxxyy$>Zgafpvxutwwuqmhimideinpqy͉~{zzvsuwvuu!7Uebbenuwwvwvrnmptohjmrtu|ㆉ~}yuqsurom0Ocfdairvvtturoqtxqijmsuw{~~xrortqol'Ibkkgkoqpmorqqrtvmccgmquy~|vpmqvxwt!D`mpmnnmlkmpqqrtumbacjorty~~|upmrw{|z@\krrqolklnpqqsune`aimnps{z}{uqorx}~!!;Tekkloonoomnpnh_]ejmoqu}zuxyvsqqsx|~'&7K]cbdgjnrqmnnkjkli^Zbhnpqs{xsuwwvsppuz~+)3AU^_`ciossrponlifc][bioqsx|yyxvuvtty}/-0:NY]_bhnrttsqnkfb_[\`gort{}}{vvxwx{}|30.5HT\`cgkortuslfb`^[Z]dmqu{zxxyv40-4DQ\_agkmoqqoje^\\[[\`gnvz~}xwxwxyzz5.-3@O[\]gllmmjhid[WWZ\\^kwx}|{xtuwvvz};0-2>LX[]fkkged_WQOTY]]jy|}zxvwwvvz}~A5./:GTY]dijjhfc_ZTLHMU]_^jx}~}zyxx>vtvyzF?0+4AQX\bfiifeb^YSKEIQ]abjquvtw}yzyxyytonptKF6-0=NV\cgiifec_ZTIBGP]cdhlopqu}}yzzyyxrmjlqOK>41EQ_dcfijnt{||{zyvqnmorRNF=4:ISZaefgghgd^TFHU^chllow|{yyxxvuvvLQUUOGJPTZafifb]TH?:?HT\aglmou|}xvz{zupnmnJKNRXUMLNT[afie`[SH?9>GT\ahmnqv||vv{}|wqljjHJHKUWRMLT\`ehd_ZSI?8=GT]binpsw|~||zvv|~~ztpljKNIIRVUNLV\^bfc_ZTL@7;DPZaglpty}~zvv{}}ytpmjNQKIOSUPMUYZ]aa^ZTL@7:BLU_ejnsx|zxxz||xspnmHIJKMORPNNPTWZ\[VOF=9>DHPZbhloquz|~}||}~~zvrruFFKMLMOOLDCMSWZYTKA;9>DGMW_fijjpw{~~}ytqswGJMNLLMMG43DPX[ZTKA96979<9873-(&'*0;IW\PD;779>ELQTV[]]_bltz~~{vrpq3001331/06;>CJTXPE968?CGJIILNPNLPTTK;9ACFEBDIQUTTSQQSTSRQOMLLOUZXVWXXSNKJKLKGDCBCDFKLGA;<>?=879;<<;:>?ACGEBCGOSRPMNPRSSQPRSRSUY[Z[_\UQNIHILNMLJHFHKMMJE??><::<=<<;?@ACEGHHJQRNMMNPRSTSRUVVX[\\]_ZPMJFGKRWUPJHIHGIJKGA>=>>:9:;<::ABCDDGKKPKJMNOQRSSUWXZ^\Y[]]WNJGEGMUZVPJHJHEGIJIE?==<<>AEFCBCFJPRRSTRRTUTSSW[^\WPJFEHMRPMJHGJNOMHJOKEB@?=::644BB>;::<>BHJFEFHKLNPQQONQQTX\__\VQMKHGKQOLJHFILLKIJNKGC@@>;:9876?@<99;>@CKMIIJLLIJONMKLOPOT[`b_[UQNOLGJNLJJIFGIIJKLKHC@@><;:;;9?@<9;>BDEHJJKLIKPNKJMTTQTY]_^[WNIKLIIKONKJIHGGIKJFA??=;:<<:AB=;=@DDCDFIIJHJOMIKOUURTX]_^]ZPIJLMLKJKPPKIHHGGHKHDA??>=<>=:CD?=?AB?=>AEGGFGKIGNRONOU[ab`_]XRLMRUUNIMKFEGJLJJFCBA??@>9CD?=@AB@=>AEGGEDCEIHHNPLKMS[bc_^]YSLKQWYRLKIFFGJLLKJGDDB?@BA@?=:BC?=?BDCBADHIGDB@BGHIKLJJKQY`b]\[VPJHLSYUOJHIHHIJKKIHFC?ADB?<;;BCA??BGEBCFIGD?;:@AEHKOSTTV[ed_^YJBBIRPORPKJIHGFILJHJHBBC>::;=DEB@ACFB>?@@<99:=>?CFHNUWXX^ijd`XJCCIOJHMLIHIKLLNOICDB??A><;?@=<<=??BEGLRVYY^jkf`WLEDHMIGKLIJLOPQRQH@@?==>?>CA@BA@>=<=AA>==?AB@?BEHJLQVW\fhd_XOHDGLMNOONOPSTTSQH@>@EEB@?@?<8CA@BA??><=A?<=?AA@??BEGIKNQTZceb_ZRKGIMPRSSRSSRQOG@>@CDBA??><3DB@BA@@=ACDGKKLRX`bab_UOLLMPSUVUURPOOMGA??@BA><<=.BDCB?<=>==@@??<9:<>@CDFILPW`bafg]UPLKMOOPQRRQQSSPIB><:<>>==?+@DDB>;=?>>BBA@><;9:;;=AAFLQW_aahjaXPKHIJJKNOPORWWSJB>;89<<>?(=AA@?BDA@A@?><<;98:>>CKTZ\_bee^ULHGEFJMOPQPRXXTJB@>:;?=:9;=&:>?>@BCCB@@><<=:668==<@FRYZ_dc`\TIEEDDHKNPQQRVVRIB?=:;>=;:;>$5;=:>C@=??><:<=<;<8447=>;>?@(0:?:>=<<:997568<<9;AJRY_c_[\WKGFFGGIJLOSVVSOG@<;::;?@@><-,9@;:<=>==>>=;987789<;8??><;:;=;99:<;:?EIMSZ__^]WMKMJILLKNRVXXTME@A@>;:=?>;6/"0;<847<>??>=<;89:<==BGJLOV_a`[TLLNJHJLLQUXYWRKEABA>;9<>><73/<@>9:<<>AB<558<>@A@<>&0==<;;N44:BECA@>==<::>@GLMRY[[XUQRTSTVVSTUVVTOG?;=>=;9:=?@>^C76?A?>>=>?>;;<=@=733:=>>?CHNTWYYWURTWXXYUPPRTUSNG=79;<;9:A@==<9:<;944:>??AFOTVWXVSQTY[ZXSMMOSTSOH=679;;::<@BAiA,4889;<>??A@<::9844:>A@@CGMPSWYXSNRZ\ZTQPMMRUSNHC><;::;;@AA>:765337<@@ADILOPWZWQKQZ][SPQNMTXUOGDB?<::<<>A@>=<:6201226=;<>?@?;6hH74:97:;;<=;:;95203424:>ADHOPOVZSMJMU\^VRPPSYZUMD@??>;<9wX=5;74;=::98:952257558=ABELPRX[WRKJNX]VRORVXWQKFB@A@<=??>>?cB7:659:877850-.3788?EEFIKOUZ\WMMQWZVRNPTWVSNHC@@>?@?=<<=oK:867887556773-)*/5899?FGFEFIPV]ZNOTUVVTQRTWXWQHB?@@A><;;}YA56:9978752/+(,0467<@BBAACIPUTNORPPVZ\\[[ZXQG?<>ABB?;9;=?hL76;:;==<:7531,(*.577:=??@ACGKQRNOQOQY_aa_^\YPF?<>ACB?;8:68?ADGHJQRNNPSW^aa`^][WODA@@ACB?=;99;gF969<>@@=9740)$&-8;8;==?CFIKMSTQOOSY_cd`[WUVPF@>?@BA?@@?>>vR?668;<<94-% #*598;=@A@?BDDBbF536;<;:850)"")1579:;?GIHKORQNLKOUZ^`\WRPRQMF@@AA?=?ABBwR8249;;962-' !(/4789:>FGFJMONKKLPTXZ[XTRQQPPJDAA@==>?@c>327:<:60+( %0569;<=@BDJNMMOQTWYYWSOPPOONJE@?BBA><;<>wJ826:<:50+( &068;=?@@ADILIILORUXYYWTQSSPMIFC@@DFEA<:;=ļZ>36:<841-'!"(/5;>?CDCDFIJEDGKOSVXYYXXWSKC?>@DGIID?<;<ƟpH468:853/)!!(/5:>@CDEGGFDDGLQSUWXYYXUOFA?@CFGFA=;;<ɯR6656774/*!!(.37<@ACFHHEDDFHMRSTUWYYXWWRIC@@BCCB>;;=ɸ]:202562,%"'*.49>?@ADFDCDGJMPQQPRVYZVTVOD@>>?ABC@<9:>ɿg@3.1451*"!%',28<==@CCDFHJMOQROQVYZUSTOFB@@A@<89>ĭsI813440*"!(-28<;;:<@BFJKJLPTVSTXZZURTSPKGGEB?<<;88:¯vL88B>70)!!&+/5889;>BFIIFHLRVUVZZWUTRPKGGFDB?><;:9ЪuNCEGIJKMOQV]_]YWXUPJFFGGFFDB@=:Q3! #')-12248>>;<=@CFHIJKMOSXZVTVVSLGFECCDCA?==Z9%#'*-02348??;99=ADFGIJKLOTXTRUTOJEEDBBCA@>>?qI.!&+-.3757=<867>@BÿſǩþĿ󬮴Ƨ½ľꥢùȦƿ¾¾ᬭٶſ쭯ҥέŽ꯰җ¾ǿ¿ȿǿĻȾǿŨծ¾»7ûſ»žĺ¼ɾ˿ګƻܭú뽹ý𫨨ļƪǿ߫۾˧ſ½ëýߧ㼿ſĽºΝľŮ¼¾ধﷲëЪ¿¾¿üƾĿިݯĽ¾켰קƾ¿uqonoruwyyxyvtsvzzxx{zursvsu~qkjkmqwz|zyz||vrsvzyvwy}zsmostw~mjikosx|}yy~yuy}~{wvx|}|}xqnptxz|~mljjnsy|}yzzw|~}{wuvyzy{}~xtrsw{}zz|tskgipx|}{|{vtvvrstsrruy|~{xy{~~{z{vxmffluz{z{}|wspponpssrqsw}~{{}~~yy|szogejrvxwxyxuplkloruutssu|zz}}{vw~twnhhmtvvuuvvtnjkntwxusqqu|}xx{|{xy~uslikryyvttutrnmnrwyytqoqw|{wwyz{{|~utmijq||xwusomrvtsttposw||}~yxzz|~~unihp||zywupmtyurppmnu{~|y|zyzz{~~|vwohflwyyz}ysttomnooquz~|y{}xwyy{zxypjhmvz{{|{uqollorttw}|{|zxxwwz{y{{snnrx|~|{}{unklptx{{xrt|}}~}ywuuz|yywuuwyzyxxyxvqosvz~~yrryz{}}xtrsxywxxz|{{zxvvuxz|~yrsxx|}wrqswxvyx{~}{xy{{zwvwxxywuvyywtvzxv|~xtrsxzxyy{|{zxz|}{xxyzzyvstvwvuw{yx}{vtuxzzxzywwxzyy{{xy||{yxyywvtv{|}yxxzuxwvvx{xvxxwy|zxwxzzywutvz{}梜|zxuv{quuvy{wttux{xuuwxyvtuwzz}ޗ~zvrt{qqnlnquvtompuzuqquwsqtx|{z{}vqnqwrnjhjmpuvnkntyuqpporurpty~}zy}~vpoquqonnqrruwtrsvyxvsrssqrvz~}|z}~zyytqqrtsqtwvvxyz{zwvxxwvvwy}}{{~~|{xtrrtrnrvvw{|}}|{{~~zuv{{y{}{{wtrrpnrvuw}~{umnuwwvx~{z|ttsrqposvuw|{zslfgotvqqv~{y}npuwuttuvx|yuqkhhkqtustx~㦢}}lnuyxx"|~ztokijnrvutuvz}}{qptwxxyz||uspmkjmqvy|wstvy|{utvsstwy{}}|}wsqppnnqvz}}vpqsuzysrzusswz~~zwvvuvyvsux{|{tnnprx}wu|yyz{}{wuuvvx{xsuxyzyuqqrt|ՙ{}{~~yvuvvwx{wrtvwwutuwy}{}}|}~{yyxwusrtuuvwtrw|{y{zxy~}{zz|{yywtssuusturrw}᧥wxywru}~{{}{zzyvvwwvrqqsuyzywtoqwyz|{wy}zxxwvwxxvspmmorw}~zuronopruurv|xuttuvwwvtpjijpv|zuvurrquwtw|yutssttsstqklpuxzuqvxvvwtsvxvy|zwuttsrrsvsmpuyzzrptxxvuvvux|}|yxxvuxzzvrruy{ypotyzzxvtsstvy|~}{yxw{}{xtuwz|}pov|}{wtrnnqstx|~|xwy{{ywuw{|~Ltsy~~{uqnijqsrtw{zwwyxwwvvy||yx|~~ztojfisusqquwvwwtsuwxz||yyz||yspmlouvsqqrsuusopvxx{}{|wxxy{ytrqqtxwtrqqrutqopvxxz|z|sxwwzywtstvzzwsqsvvututstvvw{~nsqrx{zxvxz{zyuswwtrqtupqvwy~jjimv|}{z}}zyyxwzwokjornouz~iikpx||}xwxwwxuojglokjmu|lmquz{{|}~{ssuututpkgkliggoy}~vutw{~}{ztjjpnnstpkhjkhhjpw}ᚘzzvttx}{wupfhomlqsrommliknqu|vvusprvusrninvsoorvvuronottuzqstrnosqnoontzwrpquvutsrsvttynpqpmornjlpuy|yurqqtuvvuttzmmlmpqpmjkpx{{ywsrspnrvxwstw{omklstqnmmqyzxwvtstplpuywruz~ttrrvvusrswxvrpstspnorvurxyzxwxxvwwssvwupnqrpnmoqssry{zxywsuvrqvwvrnmmlknppqw}|;:;<>??=<<=><=@ABBDEEGJNTYaioqmjgc`dijmqpmg`VQOJD?:89;=@HKI;:99:;=@A><:;>>==>A@>>@AACGLRX`inpmjid_cggilmlf^UOKHE=9;;<>AHJJ::7679<>><<>??>>@CEB><<>>?BEHNXainpnmmicbb`bfjkf^UNGC@:8:<=>@CDD::6568:;;==ACEB=;;<=>BFFKV`hmpponje`][]cgie]TLFA>:9;=>??@;:767789::<@?;::;<<;<=?CGFJR[dkoolgda^]]_cggaZQLIEB@?==?@A??A:;756789::<>=:88789:<<;;<=BGFGLU_hnolea__^^`dgfaZRNKIFEB>=>??=>B9=7457::9::;9778:<>=<;;@EEGNYdmpnea`bb_afgfc]VPMLJHD?==<;>D9<7469<:8::8:=;989=??=;:9:?EGILR[elolecded``dffd_XTPMJGC=<=<;;>D:;757:=;8;:7:>>=;;?@@=:99;?DHLRY_gmnkefhgd`_adfeb[WTNHEA;<>=<9:>AA<;>>;::<>@CEJRY`innlijle`]^`cegfa[UMFC?:;=<<=@C;<9757<<=@@<<>@@<:<=<98;>A@@BGOXaionljlmga__acehid^WOHD@;;>==?@@:;9779<==>@@>=:77;;:66;?B?>A@?@?;;=:878:=><=AA>;978;<<:9@>:>@=:778=@;;@A><;::;?BB@<>DB@@CJR[fmiecjrlfa`adffdb_\WQLFA?><??><;;<==>>=>?BEDA=>B@=>AEN[hpliiloke`^`cegijg_WOJEB?=<=BC?>>@A@?=<<@A=<=>>@@ACFDA>>@=:=@CN]ksommljie^\^adgkplbXOIEC@=<>EEA?=@A@>=?BCB?>>?@?=?BBA@<:=BHSamtplhghgd]YY]acfjie^VMFA><;=CD?>=?@?>>@BBA??@A@=>@AA??<;>DMXdmrpkeegfb\YXZ]_bgiid]TLE@<<=@@>;<=>>@B@>>?@@ACC@@?=9:<<@FOYdjmmjdfid`][YXX\agknjd]UNE>==;;=;<;<=?B?<>?@@>A>?@=:89<==?ENX`fjlkhikd]ZXWUVZ_chkje]ULE??>::><;::;>@>=?@@<:<<:>=BLTZbhjlmnld\WTSTVZ]_cghe\QHCA?=::?<899:;=>=<<>??<9:97:>;99=@HNS\eimomic\TQRW[\]_chjhaXME?;978<;7899:<=>;:=>><:9879=;::>@FKOYbinpmgc]TRTY]]^bhjje]SI@:779::78::;=??>=<;:;=<<=>@CIMOYcjopmhd`[YYXZ]ahkd\UNF?<=>=;8:;::=@AA@?>>=?A@?>><=?>>@DKNQZdlppmhd`]ZYVTVX[\^eic]YRJC@A@>=:;<;::=@@ABBCDEDB?:>BKPS]gmpplgc_ZWURQV\_``dgc_]UKGDB@?:9:<<;:=?>?ACCDEDCACEA=89??>=@GLP[empmkifa\WURQUZ^achkgb]VOJE@?B78:<=<;=>=>CEFGGEB=?A>9679<>=>BGLWbkmijkie_YUSRSW\afloke]XSMF>>E69=??>>@CEFFC><:75667:>>?ACGS^dggikhd`[URRSW\_agljfb^ZQG?=B79?BA@??ABBCEDDB=96459:9;=??@BFQ[adehifb`\URQTW[\]bffeca[QG?=?97>BBA@@AED?@DB??>;757;@BA?=>?ADIR[aeffeb__\WRPTWWX[]_`a`\VLC=;<;9=@AA@ACGE>>AA@?><:9;?CDC>;>@BFKQYagjjgb^][XSPTVTUXZ\]]ZTLD?=<=<<=?@ADFHE>=?BCBA@?>?ACB?;9=ADHLOU`ippkd_\ZYTPTVRSVY[\\[YUOIEA>?>@A@ADEFFD?>?BCA?@=;=??><;;>;8:<<;;<=<=BIPQT^gnnljhdaa\XUUXWTUW[^__`_\RD?@DECA?@AA@?@@>=>;9:;<==?DKSVY_ehkmlicaa\VSUYYUST[_^`cb`[PA<>CDA><>@??A@??>=<<;<>>=>@CKTX\`cfhjigcab]XTSVVTQRZ^\^ba]XNA7;AB=;=@B?>BA?>=:9;>AB@:9<=>??AHRY_adfecbbccba^WRPOPNPY\WY\[XTMD9;>?=<<=>==>??<:9:;>AA?:88:<<>@GQY`dfgfeddcb_VPNNOPRWXTUXZYXTM><<=?>:88;;9<@;7:;<=><;;8458:<@GQY`ehhjlkicbdb\SNOPQSTUTRSVZ]^[W<;=??><:9==;>C?<==<;:879757;>@AFOX`dghikkicbeb]TPRRQSUVVW[]\ZU;;?A@?><<>?=AEC@@?=;9988;>BDBFNW_dghiijidcec_XTVUROMPTYXWZ\ZWR?>==??>>==AFDBBA?==AB=<>?@DECGOW^eijjiiheec`\YVRLIKPWVTWZXUQ?>==@@=<<;;CE>=@ABDFEIPW^fklligeddb^WROKIKNSRPTVVTR;:=@B@;:989;<>@CEC<;ACCDHLPX`fkmppkfcbba_YOKKLMOOMLLPRRTW<;=@A>9889;<<=?BA;;=<<;;=@BACHLOYbhlnqrlgcbcb`]YROMNOTSMLLMPU@==>><877;>>=<;;>>;<=;:;;<>@@BHKPYcilmoqmgcbdb_][YVQPQWWONNIFHLQ@>=<>=:88;==<;;=<:;;<;>AACHMS\ejkhknid``cb`bb]WPPQUSKLPJGJKK@?<;??<::;<<;<;::;=<;>AADHNU^ehgdhlga^_ccbfe_WOOQQOJLQLILKH?><>?BEHNT\a``aglf`\_fgfge^WQONLKLOPLJMLI>=;??BDFKR[`__bhlf`[]bccdb\VQOMIJOQQNMONK==;;>ACA>=<9;>==@@=969;:;?@@?><:>=<==?@><:<;:<;6569<@@>DPZbhjhhgfeb^[Z[\\Z[]ZUOKLRXURQPNAB=::<>><8:=:9?A?<::67::;=@DMX[^eiijkkieb_][\\ZWSUVRNLPUSPNMMAB>;:<8:=:9?BB>;::89<;:=CJT]\\cgijlljecc`\]]\WPQSPMKLONLKKM<>@@<=@@??>;=?<:=ADA=;;<;AHPX_]]chijihfaafb^_``\VQMKIFEFFGJP:>=?A=9;>A?<;;<=<<>CHPUXY\chljgec]_ec`bca^XSNKIFEDFGFIN:<<9;<=>@B=99;=;99;==BCC?<;<=<9:;==?BBDJMNV^ekpollh`\][Y\][XSVXUQLKMNOMLK:;98;<=<:<:;=>>=?BCFKOS[cgkoqppmd]YTRUWWTQUYXTONQPPQOK=>;:=?@?>>?BA>==<;=>><;AGJLOSYbhjkmoolgc\VQORUWVSSTUUTRQPPRPJ@@=?><==<<;;<==;:AHJMOU\chijlmmhdb\TPORUVVTTSTVSPMMPOJBB>=?>;<=<;;<>>=;::;:?DDGLSZ_cfjlkifcb\SQQTVVUUVWSRUQLIHJKK൳¿¿Ѷ¾ÿζÿʶýȵŸ̶θ۫ƽζŽд¾ÿҲձŀ֯ӮЯݭή߼¾έѮÿϮήѰﯭҳ᳸СԱԭػӫѫϰ˳ÿ˴ޜÿƩεϵ洹»޽д¶аŻϩ¼̫ܴ̭̯ͨ˰˱G̴͸ɻ¸ö˵Ƿټ̺ﹷǺ۶ϽζҭͲݫ˴¼·º弾㨬ͨƻú䰯¹ЭĹźƺĻƺŹ󷶳˲ûŽþ¾}}}{|yy~~}}~}~|z}~||~}{|~~~Տ~~}{xz}}~~|{|}}|zvy鎐zz{yxxyz{zxz~~{zz~~~~|{}Հ{~}{{|}~š|}~|~~}|}yy{|욛yy}脀zz}{|׍yy{~}}z||}|~녇ۢxyxx}~vwuvzzyy|wwy{{xuux~~}}zz{{zwtsuz}}}~{wwvusswzz~}uqtvvutwyy~}዆{vnlswxxwwy{|y~Ǐ~wsmlrvy{|zz|}z|~ߌ{utporux{|{z{|yzՊ~{{{wtuuvyywy|yvvz~}~}zxurpquwsrtrru{~}{upmmrsonoopu}~|~zuqpqstssuuw}҈{xzyustuuwz||{{}~~yqqy}}~}ywuttrsuwy{~~toqzyxz{zxvtrpprsuy}~}{}yrqu|rruxzywspnmnpruxzyw{}wtu{rrtwyxtqnnopruvwxx||xwzuwwxvpnnpsuxzzywy}}{{|~|}z{zyxursttvxyxwux}}{yxvuxywuvvutssw~}xwyyxyywuurmmnotz~犇}yw{|{zxwvwsmlnqtx}|{~~zvvx{yttvwy|~~}{~~yuux||xy{}~}z}~|yvtw||y{~ツ~~ُ{y{{zyxyz|yvz񑐎~}ڌ{z{{yyz||zvty}zy{|{wtsyʕ||}|yvttx{}~|yvvwtsv{}{~~|{yyxwrosx}xw}}zxyzzyvqosvy}~~}vw~{yywyvtwxvy~~yxy~~{zzxtuwxxzyuw|~~}{wssuz}}|z{zxtqouzywtw|}xsoqrs{~|}|zyyxvrpv|ywux}}ytqqpx~yvvwywuy|yxw{~}zvsrsx~~΁~vrqssruwuvx{~~}zxvvx{~~扁wolnnoqrsuy{}{z}~|{zz|́|tqqtsrrswz||zz|}~ztvxzyvuvz}}|zz|}~zw}}zxx|}{|}||~}y|ĉ|{}xvv|}y}}y{~~~ytpqy|y}{|~~~}zyvqouxy~|}}||zx|~~{xxroptx}~~zwwusz}~~~zxyxuplkmtz|{yxutz~||~{vsqoptz|{{yw||{{zy{}JDBIIFFDEGEAADIICABGKNLFEGLPTX\[YWX[ZUNLTYZ[ZYWVWWZ^bfhedfilLMGELLGFFECA@CFFD@ADJNOKFDEKOQUYWTSV[ZURRX\``^ZY\[YWV]a`bdbacflHLFDKLHFDFEA?@EHGECCEFHKLKIINQPQSRPRTWVTSSVY\ZWY\`^XTU]ba`_\\adfEIDCHJHECEEA@@DGEDEECDJMOMLPSRQQONRUUTSSTVXURY^a]VSU^ba^\Z[addDGCADEDDECB@@?>@EECCENQPNLPTXXTQPUYZYWTSUVVSS[`]XSTYab\[\]`ehiEGDBDDBBCBAA@?=;=BGHIIJHCAIPWQJJKKIHMQQPRUUVXYY[\[YY\^YWZahgeehoABEHIHECBDDB@@CFHHGBAGNWRKLMOLGLQOOQSURQX[[_a^\Z\^[Y\cjjhegm;=ADFFDFIJKKGCDFGHIJJECFMUQKJJMJEJOOPRRQJJT[``_``][YXY]_`djigfgj;=?BEGGILNONHABDFGHKMHDCHPPMIHJHDINQSUTPJIQY_aa`]\\ZZ`baekihijj=??AEILKKOQNG>@DFGHLOKE@BJNOJHIGEIORUWUQMLQUZ]_`_\]a`_cdbekjilmk>?==BEECCLOMGADGHHLPNIBCHLOMMLNQSRPONNPTSPTY\][\_`aegfghghlmk?=;;?@=<=GLKIFGIILPOLFEGKNQRPQSRRNHHLOSWSIKRX[[\]_behigeefjlj<:<>=<;=;;<>ABFJKKJGDDGHGMRRQNMLIGHIHJNMOYYRPPSVYZ\afdcdccgklnr??==>>=<;<=?CHLOKIGGFEHIINSSRQNKFCEGJLNMMTVTSSTUVY^cgdcedchlkmp=:89<;;=@ELPJECEHIIKKOSTTSPLEADHKMNMMOQTUUTYadecdffeikhil;988:<>??>==AGKKFBBCFGIKKQUSQPNKC@HOSTRQPPONQTUUVZ_^]`cfhhihefj;;::;<>?@?=AGHFA@CDDFGHIJPVROMLJDAIPUVUSRQNJMSTVW[^[Y]bfijigdei?@><;;::;??@<=@@>=AKJGGEAAFMROMLLJGBAFMTSQQOLMPRUW\`_\Z\bdefgfgjADDCB@>==??<<>?@?EQPJGDEGKOPLIHIIGEEJPQRSPKKMPSV[`\WUVZ_bbabfmDDBA@?>??@?==>?@@EMNLIHKMONLHFFGHHFCA@ELPTXSHJPTVWXWVUVXZ^baadhlEB@>==>@A?==>?ADGJLLMOPPMHFEEFHHF@==>@@?<;=<<<>BB@>;9:==AA?;88;>??CDCDGLPMMKHJLMNLE??ADEEFJUWQQSRT[]\\^adfggffiih<<979<@AA?>@AACFMQONNLJJKLLJFBCEHGEDGNQQSSRSVXYYZ]`bdeddghg<;::<;878;>ABA@?>?BCFMQONMMJIIHFEEHJKIGGHKOTTSSRPPQQSX[\^abbdfg>==><879<=@CFKPQPNNLJIGEFHJMNOOMKJKMNNOPPQW[\_bbcehk??@>:9:=@A?==;?=<>>=<;>@?=;;9:>BDGILMLNPQQOLIMPMLONMNOOMKMPRQNMOQTWZ_dijihjn?@<;<>?>=@A@><<:;?BDDEIJJMPSTROLPROMNLJNQRPMPUVSLJNRVX[afkmmjjmBB>;;=ADDC@??>?@BDBCGJJLNRTRPOPPQPOMMPTTQKQXVQHGMRX\_bfknnmkjIF?;;=?>=?BDDBBAA@BEDEILONMRUUTSQOQPMLMOQSPJQXVRKKNRV[`cfhjkjhfPH@;<=??>=>ACCBAACGHJLPURNQTWWUQOQOJJLLMPOJOVUTRQQSY_deceffdaMD>;;<>??@@?ACCBABFILKLOTYUQPQSSRQSPGFJLNPOMMOQRSTUSRX]a`^bdcbbJB?==>?ACC>?BCB@CJNNKKPTXVSPOPPQQRUQFEHNQNMNKIMQQTWTRVZ]\\adccfKECB@@?@AED=<>BDADKLJGGLOPRTRQRQOPQSPHFHPRGFLJHNQOQUSPRUZ[]cgehoOKHEB@@ABEC=;=@B?BIJIGGKLLPROMOOPMHHKRREBHIILNLOTRPQUY]`dgfiqUQLGB@@BCB@==>=<;>EIJJKLNNMHFGKPPNKIGKQRNFBDHLIHINUSRUY\`cfgehmVSNJFCAA@>=>>;9:>CGJMNLLJGDCFIMMKGEFKPMIBACINIGJOVVY\]aegiijlSSPMJGB@>;<>?>:8<=@EHHEDDA>>@CHMNMJGDFIIHEGLNNKLU[^\ZZ\_bfkoqqnHLSUOICBB@=:>=:=ACDCCB?<<=?FOPNMJEEHKLIKOOMKOZ``\XX\aehloqqnKOTUPICAA>:9:=?><:;>BEGHFA=;::BMKIKKHIKOPLJJLNMQ[_]WRW_hkjjklljMRSSPKEBAA?:89>A?=;<:@JHFJKIIJNPLJHKOOSZ][UQY`fhgghiigOTQOPNHC@@>;;BEFGGFFEB@=@FFIJIHHKMLJHKPRTXZZUS\`__adfggeQVROPOMF?;;=;:=@>=<>ADEDBACEBABEGECFHIIKPRPMKLNPSYZXWX]_\]`dfgfdRWSPOOG>88><79;;<>@BCA>=ADAAFIIEBEGJLNTWSPNMLOSZZWZ]^^]_aehhfdQVURMJHA;9:=<88:<>>@BC@?ADE@AHKJHGIMRQOSUOLKLPUXWXZ]`bcabdhjjhgRVVRLGC=:<>@=::ADEDCBBECACJLKJKMNNPTSJGJNSXXQQW[_adhmpmjjSWTPLGB??FIFB>>@CCBEGECEEDCCEHHFFHLOPQQMKLOSXYVVZ^acfkoqlhjkjNQQOKGCBCFGEB><?CJQVUQNMQRPPRX\^_`bdgilnmifkljKLLJECBBCBBA@@=<@A@DIEBCDECBAA?=?DIOUTONNQRRTWZ\]^aabehijjedhihIHHFA?ABB?>?@A><@BACEA@DFECA@?@?=AEHLPOLNPRTUX[\\Z[_``dgihfcbeggGFED@??AB?>ACC?;<=?BDA@EHHDABCB@?BEGHHIJMPTXZZ]Y\_bfjpleddegjJKIFBABBAABFFC?=<=>ADCBDFHGEFFDCBCEFGGINTY\][Z]_\\^aehlrmdceegkRXRKFFHDADHMJCAABA>@DFFBAEILIGFFGEDGJMKJS[^_^\Z^abcfghiknjdbcegjůl